Enhanced Validation

Anti-ZEB1 Antibody

zinc finger E-box binding homeobox 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human ZEB1
Alternative Gene Names
AREB6, BZP, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
Price
$437.00
Product Number
AMAb90510
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
zinc finger E-box binding homeobox 1
Target gene
ZEB1
Belongs to Antibody panel
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017863 (77%)

Mouse ENSMUSG00000024238 (74%)

Clonality
Monoclonal
Clone ID
CL0151
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
zinc finger E-box binding homeobox 1
Gene Name
ZEB1
Alternative Gene Names
AREB6, BZP, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Kinchen J, Chen HH, Parikh K, Antanaviciute A, Jagielowicz M, Fawkner-Corbett D, Ashley N, Cubitt L, Mellado-Gomez E, Attar M, Sharma E, Wills Q, Bowden R, Richter FC, Ahern D, Puri KD, Henault J, Gervais F, Koohy H, Simmons A

Structural Remodeling of the Human Colonic Mesenchyme in Inflammatory Bowel Disease

Cell , 2018 Oct 4; 175(2):372-386.e17

PubMed ID: 30270042 DOI: 10.1016/j.cell.2018.08.067

Roy A, Attarha S, Weishaupt H, Edqvist PH, Swartling FJ, Bergqvist M, Siebzehnrubl FA, Smits A, Pontén F, Tchougounova E

Serglycin as a potential biomarker for glioma: association of serglycin expression, extent of mast cell recruitment and glioblastoma progression

Oncotarget , 2017 Mar 1; 8(15):24815-24827. Epub 2017 Mar 1

PubMed ID: 28445977 DOI: 10.18632/oncotarget.15820

Müller S, Raulefs S, Bruns P, Afonso-Grunz F, Plötner A, Thermann R, Jäger C, Schlitter AM, Kong B, Regel I, Roth WK, Rotter B, Hoffmeier K, Kahl G, Koch I, Theis FJ, Kleeff J, Winter P, Michalski CW

Next-generation sequencing reveals novel differentially regulated mRNAs, lncRNAs, miRNAs, sdRNAs and a piRNA in pancreatic cancer

Mol Cancer , 2015 Apr 25; 14:94. Epub 2015 Apr 25

PubMed ID: 25910082 DOI: 10.1186/s12943-015-0358-5

Varma S, Mahavadi P, Sasikumar S, Cushing L, Hyland T, Rosser AE, Riccardi D, Lu J, Kalin TV, Kalinichenko VV, Guenther A, Ramirez MI, Pardo A, Selman M, Warburton D

Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis

Am J Physiol Lung Cell Mol Physiol , 2014 Mar 1; 306(5):L405-L419. Epub 2013 Dec 27

PubMed ID: 24375798 DOI: 10.1152/ajplung.00143.2013

Did we miss your publication?

Have you published using AMAb90510? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch