1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-SOX9
Enhanced Validation

Anti-SOX9 Antibody

SRY (sex determining region Y)-box 9
References (2)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human SOX9
Alternative Gene Names
CMD1, CMPD1, SRA1
Open Datasheet
Price
$450.00
Product Number
AMAb90795
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[11 pictures]
Immunofluorescence staining of mouse embryo E14 shows nuclear immunoreactivity in the developing eye.
Show all images
[2 pictures]
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SOX9 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Show all images
[1 pictures]
Immunofluorescence staining of U-251 cells using the anti-SOX9 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Human Protein Atlas

View this protein on the Human Protein Atlas
Target Protein
SRY (sex determining region Y)-box 9
Target Gene
SOX9
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Epitope
Binds to an epitope located within the peptide sequence SQRTHIKTEQLSPSH as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000000567 (97%)

Rat ENSRNOG00000002607 (96%)

Clonality
Monoclonal
Clone ID
CL0639
Isotype
IgG2a
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 2-10 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for AMAb90795 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for AMAb90795 on the Human Protein Atlas
Protein Name
SRY (sex determining region Y)-box 9
Gene Name
SOX9
Alternative Gene Names
CMD1, CMPD1, SRA1
UniProt ID
P48436
Gene (Ensembl)
ENSG00000125398
Entrez Gene ID
Entrez gene: 6662
Shipping
Normally shipped at ambient temperature.
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Tanaka J, Ogawa M, Hojo H, Kawashima Y, Mabuchi Y, Hata K, Nakamura S, Yasuhara R, Takamatsu K, Irié T, Fukada T, Sakai T, Inoue T, Nishimura R, Ohara O, Saito I, Ohba S, Tsuji T, Mishima K

Generation of orthotopically functional salivary gland from embryonic stem cells

Nat Commun , 2018 Oct 11; 9:4216. Epub 2018 Oct 11

PubMed ID: 30310071 DOI: 10.1038/s41467-018-06469-7

Chen W, Zhao W, Zhang L, Wang L, Wang J, Wan Z, Hong Y, Yu L

MALAT1-miR-101-SOX9 feedback loop modulates the chemo-resistance of lung cancer cell to DDP via Wnt signaling pathway

Oncotarget , 2017 Oct 9; 8(55):94317-94329. Epub 2017 Oct 9

PubMed ID: 29212230 DOI: 10.18632/oncotarget.21693

Did we miss your publication?

Have you published using AMAb90795? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-SOX9 (HPA001758)
Corresponding Antigens
PrEST Antigen SOX9 (APrEST84775)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-SOX9