Anti-SCGN Antibody

secretagogin, EF-hand calcium binding protein
Recommended Applications
Product Description
Monoclonal Antibody against Human SCGN
Alternative Gene Names
CALBL, DJ501N12.8, SECRET, SEGN
Price
$437.00
Product Number
AMAb90630
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
secretagogin, EF-hand calcium binding protein
Target gene
SCGN
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016628 (96%)

Mouse ENSMUSG00000021337 (96%)

Clonality
Monoclonal
Clone ID
CL0271
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
secretagogin, EF-hand calcium binding protein
Gene Name
SCGN
Alternative Gene Names
CALBL, DJ501N12.8, SECRET, SEGN
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shi TJ, Xiang Q, Zhang MD, Tortoriello G, Hammarberg H, Mulder J, Fried K, Wagner L, Josephson A, Uhlén M, Harkany T, Hökfelt T

Secretagogin is expressed in sensory CGRP neurons and in spinal cord of mouse and complements other calcium-binding proteins, with a note on rat and human.

Mol Pain , 2012 Oct 29; 8:80. Epub 2012 Oct 29

PubMed ID: 23102406 DOI: 10.1186/1744-8069-8-80

Did we miss your publication?

Have you published using AMAb90630? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch