1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-SATB2

Anti-SATB2 Antibody

SATB homeobox 2
References (1)
Recommended Applications
Product Description
Monoclonal Antibody against Human SATB2
Alternative Gene Names
FLJ21474, KIAA1034
Open Datasheet
Price
$445.00
Product Number
AMAb90682
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
Show all images
[2 pictures]
Lane 1: Marker [kDa]
Lane 2: Human cell line HEL
Show all images
[1 pictures]
Immunofluorescence staining of U-2 OS cells using the Anti-SATB2 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Human Protein Atlas

View this protein on the Human Protein Atlas
Target Protein
SATB homeobox 2
Target Gene
SATB2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSPQLSPQLV
Epitope
Binds to an epitope located within the peptide sequence HSTPIRNQVPALQPI as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038331 (100%)

Rat ENSRNOG00000010188 (100%)

Clonality
Monoclonal
Clone ID
CL0323
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 2-10 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for AMAb90682 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for AMAb90682 on the Human Protein Atlas
Protein Name
SATB homeobox 2
Gene Name
SATB2
Alternative Gene Names
FLJ21474, KIAA1034
UniProt ID
Q9UPW6
Gene (Ensembl)
ENSG00000119042
Entrez Gene ID
Entrez gene: 23314
Shipping
Normally shipped at ambient temperature.
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Jaitner C, Reddy C, Abentung A, Whittle N, Rieder D, Delekate A, Korte M, Jain G, Fischer A, Sananbenesi F, Cera I, Singewald N, Dechant G, Apostolova G

Satb2 determines miRNA expression and long-term memory in the adult central nervous system

eLife , 2016 Nov 29; 5:e17361. Epub 2016 Nov 29

PubMed ID: 27897969 DOI: 10.7554/eLife.17361

Did we miss your publication?

Have you published using AMAb90682? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-SATB2