Enhanced Validation

Anti-S100B Antibody

S100 calcium binding protein B
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Monoclonal Antibody against Human S100B
Alternative Gene Names
S100beta
Price
$437.00
Product Number
AMAb91038
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
S100 calcium binding protein B
Target gene
S100B
Belongs to Antibody panel
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000033208 (99%)

Rat ENSRNOG00000001295 (98%)

Clonality
Monoclonal
Clone ID
CL2720
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
S100 calcium binding protein B
Gene Name
S100B
Alternative Gene Names
S100beta
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Allard DE, Wang Y, Li JJ, Conley B, Xu EW, Sailer D, Kimpston C, Notini R, Smith CJ, Koseoglu E, Starmer J, Zeng XL, Howard JF Jr, Hoke A, Scherer SS, Su MA

Schwann cell–derived periostin promotes autoimmune peripheral polyneuropathy via macrophage recruitment

J Clin Invest , 2018 Sep 17; 128(10):4727-4741. Epub 2018 Sep 17

PubMed ID: 30222134 DOI: 10.1172/JCI99308

Sharma S, Khadimallah I, Corya AW, Ali YO, Rao X, Liu Y, Lu HC

Presymptomatic change in microRNAs modulates Tau pathology

Sci Rep , 2018 Jun 18; 8:9251. Epub 2018 Jun 18

PubMed ID: 29915328 DOI: 10.1038/s41598-018-27527-6

Lin YT, Seo J, Gao F, Feldman HM, Wen HL, Penney J, Cam HP, Gjoneska E, Raja WK, Cheng J, Rueda R, Kritskiy O, Abdurrob F, Peng Z, Milo B, Yu CJ, Elmsaouri S, Dey D, Ko T, Yankner BA, Tsai LH

APOE4 causes widespread molecular and cellular alterations associated with Alzheimer’s disease phenotypes in human iPSC-derived brain cell types

Neuron , 2018 May 31; 98(6):1141-1154.e7. Epub 2018 May 31

PubMed ID: 29861287 DOI: 10.1016/j.neuron.2018.05.008

Cao J, Lin Y, Han Y, Ding S, Fan Y, Pan Y, Zhao B, Guo Q, Sun W, Wan J, Tong X

Expression of nerve growth factor carried by pseudotyped lentivirus improves neuron survival and cognitive functional recovery of post‐ischemia in rats

CNS Neurosci Ther , 2018 Feb 6; 24(6):508-518. Epub 2018 Feb 6

PubMed ID: 29409115 DOI: 10.1111/cns.12818

Tripathi P, Rodriguez-Muela N, Klim JR, de Boer AS, Agrawal S, Sandoe J, Lopes CS, Ogliari KS, Williams LA, Shear M, Rubin LL, Eggan K, Zhou Q

Reactive Astrocytes Promote ALS-like Degeneration and Intracellular Protein Aggregation in Human Motor Neurons by Disrupting Autophagy through TGF-β1

Stem Cell Reports , 2017 Jul 14; 9(2):667-680. Epub 2017 Jul 14

PubMed ID: 28712846 DOI: 10.1016/j.stemcr.2017.06.008

Barca-Mayo O, Pons-Espinal M, Follert P, Armirotti A, Berdondini L, De Pietri Tonelli D

Astrocyte deletion of Bmal1 alters daily locomotor activity and cognitive functions via GABA signalling

Nat Commun , 2017 Feb 10; 8:14336. Epub 2017 Feb 10

PubMed ID: 28186121 DOI: 10.1038/ncomms14336

Did we miss your publication?

Have you published using AMAb91038? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch