Enhanced Validation

Anti-RBM3 Antibody

RNA binding motif (RNP1, RRM) protein 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human RBM3
Alternative Gene Names
IS1-RNPL
Price
$437.00
Product Number
AMAb90655
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
RNA binding motif (RNP1, RRM) protein 3
Target gene
RBM3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000005387 (96%)

Mouse ENSMUSG00000031167 (94%)

Clonality
Monoclonal
Clone ID
CL0296
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
RNA binding motif (RNP1, RRM) protein 3
Gene Name
RBM3
Alternative Gene Names
IS1-RNPL
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Karnevi E, Dror LB, Mardinoglu A, Elebro J, Heby M, Olofsson SE, Nodin B, Eberhard J, Gallagher W, Uhlén M, Jirström K

Translational study reveals a two-faced role of RBM3 in pancreatic cancer and suggests its potential value as a biomarker for improved patient stratification

Oncotarget , 2017 Dec 15; 9(5):6188-6200. Epub 2017 Dec 15

PubMed ID: 29464064 DOI: 10.18632/oncotarget.23486

Boman K, Andersson G, Wennersten C, Nodin B, Ahlgren G, Jirström K

Podocalyxin-like and RNA-binding motif protein 3 are prognostic biomarkers in urothelial bladder cancer: a validatory study

Biomark Res , 2017 Mar 14; 5:10. Epub 2017 Mar 14

PubMed ID: 28293425 DOI: 10.1186/s40364-017-0090-y

Olofsson SE, Nodin B, Gaber A, Eberhard J, Uhlén M, Jirström K, Jerkeman M

Low RBM3 Protein Expression Correlates with Clinical Stage, Prognostic Classification and Increased Risk of Treatment Failure in Testicular Non-Seminomatous Germ Cell Cancer.

PLoS One , 2015; 10(3):e0121300

PubMed ID: 25811459 DOI: 10.1371/journal.pone.0121300

Florianova L, Xu B, Traboulsi S, Elmansi H, Tanguay S, Aprikian A, Kassouf W, Brimo F

Evaluation of RNA-binding motif protein 3 expression in urothelial carcinoma of the bladder: an immunohistochemical study.

World J Surg Oncol , 2015 Nov 14; 13(None):317

PubMed ID: 26577765 DOI: 10.1186/s12957-015-0730-3

Dubois L, Andersson K, Asplund A, Björkelund H

Evaluating real-time immunohistochemistry on multiple tissue samples, multiple targets and multiple antibody labeling methods

BMC Res Notes , 2013 Dec 18; 6:542. Epub 2013 Dec 18

PubMed ID: 24350799 DOI: 10.1186/1756-0500-6-542

Boman K, Segersten U, Ahlgren G, Eberhard J, Uhlén M, Jirström K, Malmström PU

Decreased expression of RNA-binding motif protein 3 correlates with tumour progression and poor prognosis in urothelial bladder cancer.

BMC Urol , 2013 Apr 8; 13(None):17

PubMed ID: 23565664 DOI: 10.1186/1471-2490-13-17

Nodin B, Fridberg M, Jonsson L, Bergman J, Uhlén M, Jirström K

High MCM3 expression is an independent biomarker of poor prognosis and correlates with reduced RBM3 expression in a prospective cohort of malignant melanoma

Diagn Pathol , 2012 Jul 17; 7:82. Epub 2012 Jul 17

PubMed ID: 22805320 DOI: 10.1186/1746-1596-7-82

Hjelm B, Brennan DJ, Zendehrokh N, Eberhard J, Nodin B, Gaber A, Pontén F, Johannesson H, Smaragdi K, Frantz C, Hober S, Johnson LB, Påhlman S, Jirström K, Uhlen M

High nuclear RBM3 expression is associated with an improved prognosis in colorectal cancer.

Proteomics Clin Appl , 2011 Dec; 5(11-12):624-35

PubMed ID: 21956899 DOI: 10.1002/prca.201100020

Jonsson L, Gaber A, Ulmert D, Uhlén M, Bjartell A, Jirström K

High RBM3 expression in prostate cancer independently predicts a reduced risk of biochemical recurrence and disease progression.

Diagn Pathol , 2011 Sep 28; 6:91. Epub 2011 Sep 28

PubMed ID: 21955582 DOI: 10.1186/1746-1596-6-91

Ehlén Å, Nodin B, Rexhepaj E, Brändstedt J, Uhlén M, Alvarado-Kristensson M, Pontén F, Brennan DJ, Jirström K

RBM3-regulated genes promote DNA integrity and affect clinical outcome in epithelial ovarian cancer.

Transl Oncol , 2011 Aug; 4(4):212-21. Epub 2011 Aug 1

PubMed ID: 21804916

Jonsson L, Bergman J, Nodin B, Manjer J, Pontén F, Uhlén M, Jirström K

Low RBM3 protein expression correlates with tumour progression and poor prognosis in malignant melanoma: an analysis of 215 cases from the Malmö Diet and Cancer Study.

J Transl Med , 2011 Jul 21; 9:114. Epub 2011 Jul 21

PubMed ID: 21777469 DOI: 10.1186/1479-5876-9-114

Ehlén A, Brennan DJ, Nodin B, O'Connor DP, Eberhard J, Alvarado-Kristensson M, Jeffrey IB, Manjer J, Brändstedt J, Uhlén M, Pontén F, Jirström K

Expression of the RNA-binding protein RBM3 is associated with a favourable prognosis and cisplatin sensitivity in epithelial ovarian cancer.

J Transl Med , 2010 Aug 20; 8:78. Epub 2010 Aug 20

PubMed ID: 20727170 DOI: 10.1186/1479-5876-8-78

Did we miss your publication?

Have you published using AMAb90655? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch