Anti-NLRP3 Antibody

NLR family, pyrin domain containing 3
Recommended Applications
Product Description
Monoclonal Antibody against Human NLRP3
Alternative Gene Names
AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, FCAS, FCU, MWS, NALP3, PYPAF1
Price
$437.00
Product Number
AMAb90569
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
NLR family, pyrin domain containing 3
Target gene
NLRP3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
Epitope
Binds to an epitope located within the peptide sequence EKAKRDEPKW as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032691 (79%)

Rat ENSRNOG00000003170 (78%)

Clonality
Monoclonal
Clone ID
CL0210
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
NLR family, pyrin domain containing 3
Gene Name
NLRP3
Alternative Gene Names
AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, FCAS, FCU, MWS, NALP3, PYPAF1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature.
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Did we miss your publication?

Have you published using AMAb90569? Please let us know and we will be happy to include your reference on this page.

Read more

ANTIBODY TESTING REPORT - NALP3 Antibodies

Contribution from Antibody Resource (www.antibodyresource.com) — January 18, 2017

Antibody Resource is spearheading an initiative designed to compare antibodies from numerous suppliers using identical samples/tissues and an identical protocol. In doing so, they hope to enable scientists to form an unrivalled opinion of which is the most suitable antibody for their research and which is going to require the least amount of optimization, a process which can often take weeks or months.

For the purposes of the antibody comparison initiative, the best antibodies from each manufacturer were selected and compared side-by-side using the same experimental conditions to provide a direct comparison. The antibodies were collected centrally, repackaged and given an internal reference ID prior to delivery to independent laboratories to ensure objective testing and to minimize bias.

Anti-NALP3 AMAb90569 antibody (M80 in the test) exhibited immunoreactivity in both cell lysates with bands around the expected MW of 118kDa. Anti-NALP3 AMAb90569 was one of only two antibodies that showed supportive results in the test.  

amab90569_wb

Western blot analysis in 1. THP1 whole cell lysate, 2. Jurkat whole cell lysate using Anti-NLRP3 Antibody (AMAb90569)

The full report is available here

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch