Anti-NAPRT Antibody

nicotinate phosphoribosyltransferase
Recommended Applications
Product Description
Monoclonal Antibody against Human NAPRT
Alternative Gene Names
NAPRT1, PP3856
Price
$437.00
Product Number
AMAb90725
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
nicotinate phosphoribosyltransferase
Target gene
NAPRT
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV
Epitope
Binds to an epitope located within the peptide sequence IRKVFRAAAA as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022574 (86%)

Rat ENSRNOG00000007939 (82%)

Clonality
Monoclonal
Clone ID
CL0366
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
nicotinate phosphoribosyltransferase
Gene Name
NAPRT
Alternative Gene Names
NAPRT1, PP3856
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Cole J, Guiot MC, Gravel M, Bernier C, Shore GC, Roulston A

Novel NAPRT specific antibody identifies small cell lung cancer and neuronal cancers as promising clinical indications for a NAMPT inhibitor/niacin co-administration strategy

Oncotarget , 2017 Sep 12; 8(44):77846-77859. Epub 2017 Sep 12

PubMed ID: 29100430 DOI: 10.18632/oncotarget.20840

Did we miss your publication?

Have you published using AMAb90725? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch