1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-MRC1

Anti-MRC1 Antibody

mannose receptor, C type 1
References (2)
Recommended Applications
Product Description
Monoclonal Antibody against Human MRC1
Alternative Gene Names
bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
Open Datasheet
Price
$445.00
Product Number
AMAb90746
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human lung shows strong immunoreactivity in macrophages.
Show all images
[1 pictures]
Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate

Human Protein Atlas

View this protein on the Human Protein Atlas
Target Protein
mannose receptor, C type 1
Target Gene
MRC1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Epitope
Binds to an epitope located within the peptide sequence VSPSAVQTAACNQDA as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000018251 (86%)

Mouse ENSMUSG00000026712 (84%)

Clonality
Monoclonal
Clone ID
CL0387
Isotype
IgG2b
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for AMAb90746 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
mannose receptor, C type 1
Gene Name
MRC1
Alternative Gene Names
bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
UniProt ID
P22897
Gene (Ensembl)
ENSG00000260314
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Venè R, Costa D, Augugliaro R, Carlone S, Scabini S, Casoni Pattacini G, Boggio M, Zupo S, Grillo F, Mastracci L, Pitto F, Minghelli S, Ferrari N, Tosetti F, Romairone E, Mingari MC, Poggi A, Benelli R

Evaluation of Glycosylated PTGS2 in Colorectal Cancer for NSAIDS-Based Adjuvant Therapy

Cells , 2020 Mar 11; 9(3):683. Epub 2020 Mar 11

PubMed ID: 32168749 DOI: 10.3390/cells9030683

Saylor J, Ma Z, Goodridge HS, Huang F, Cress AE, Pandol SJ, Shiao SL, Vidal AC, Wu L, Nickols NG, Gertych A, Knudsen BS

Spatial Mapping of Myeloid Cells and Macrophages by Multiplexed Tissue Staining

Front Immunol , 2018 Dec 14; 9:2925. Epub 2018 Dec 14

PubMed ID: 30619287 DOI: 10.3389/fimmu.2018.02925

Did we miss your publication?

Have you published using AMAb90746? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-MRC1 (HPA004114)
Anti-MRC1 (HPA045134)
Corresponding Antigens
PrEST Antigen MRC1 (APrEST86249)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-MRC1