1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-LAMA3

Anti-LAMA3 Antibody

laminin, alpha 3
References (1)
Recommended Applications
Product Description
Monoclonal Antibody against Human LAMA3
Alternative Gene Names
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Open Datasheet
Price
$445.00
Product Number
AMAb91123
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium.
Show all images
[1 pictures]
Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.

Human Protein Atlas

View this protein on the Human Protein Atlas
Target Protein
laminin, alpha 3
Target Gene
LAMA3
Belongs to Antibody Panel
Laminin Markers
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Epitope
Binds to an epitope located within the peptide sequence EINSLQSDFT as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024421 (74%)

Rat ENSRNOG00000011300 (71%)

Clonality
Monoclonal
Clone ID
CL3112
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for AMAb91123 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
laminin, alpha 3
Gene Name
LAMA3
Alternative Gene Names
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
UniProt ID
Q16787
Gene (Ensembl)
ENSG00000053747
Entrez Gene ID
Entrez gene: 3909
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Ascierto ML, Makohon-Moore A, Lipson EJ, Taube JM, McMiller TL, Berger AE, Fan J, Kaunitz GJ, Cottrell TR, Kohutek ZA, Favorov A, Makarov V, Riaz N, Chan TA, Cope L, Hruban RH, Pardoll DM, Taylor BS, Solit DB, Iacobuzio-Donahue CA, Topalian SL

Transcriptional mechanisms of resistance to anti-PD-1 therapy

Clin Cancer Res , 2017 Feb 13; 23(12):3168-3180. Epub 2017 Feb 13

PubMed ID: 28193624 DOI: 10.1158/1078-0432.CCR-17-0270

Did we miss your publication?

Have you published using AMAb91123? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-LAMA3 (HPA009309)
Corresponding Antigens
PrEST Antigen LAMA3 (APrEST71201)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-LAMA3