Enhanced Validation

Anti-GFAP Antibody

glial fibrillary acidic protein
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human GFAP
Alternative Gene Names
FLJ45472
Price
$437.00
Product Number
AMAb91033
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
glial fibrillary acidic protein
Target gene
GFAP
Belongs to Antibody panel
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Epitope
Binds to an epitope located within the peptide sequence PVQTFSNLQIRETSL as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002919 (100%)

Mouse ENSMUSG00000020932 (98%)

Clonality
Monoclonal
Clone ID
CL2713
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:5000 - 1:10000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
glial fibrillary acidic protein
Gene Name
GFAP
Alternative Gene Names
FLJ45472
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Liu Y, Sorce S, Nuvolone M, Domange J, Aguzzi A

Lymphocyte activation gene 3 (Lag3) expression is increased in prion infections but does not modify disease progression

Sci Rep , 2018 Oct 2; 8:14600. Epub 2018 Oct 2

PubMed ID: 30279468 DOI: 10.1038/s41598-018-32712-8

Did we miss your publication?

Have you published using AMAb91033? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch