Anti-CNP Antibody

2',3'-cyclic nucleotide 3' phosphodiesterase
Recommended Applications
Product Description
Monoclonal Antibody against Human CNP
Price
$445.00
Product Number
AMAb91072
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
2',3'-cyclic nucleotide 3' phosphodiesterase
Target Gene
CNP
Belongs to Antibody Panel
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
Epitope
Binds to an epitope located within the peptide sequence LSEQQLQLWPSDVDK as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017496 (77%)

Mouse ENSMUSG00000006782 (76%)

Clonality
Monoclonal
Clone ID
CL2887
Isotype
IgG2b
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:5000 - 1:10000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 2-10 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
2',3'-cyclic nucleotide 3' phosphodiesterase
Gene Name
CNP
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Swire M, Kotelevtsev Y, Webb DJ, Lyons DA, ffrench-Constant C

Endothelin signalling mediates experience-dependent myelination in the CNS

eLife , 2019 Oct 28; 8:e49493. Epub 2019 Oct 28

PubMed ID: 31657718 DOI: 10.7554/eLife.49493

Milbreta U, Lin J, Pinese C, Ong W, Chin JS, Shirahama H, Mi R, Williams A, Bechler ME, Wang J, ffrench-Constant C, Hoke A, Chew SY

Scaffold-Mediated Sustained, Non-viral Delivery of miR-219/miR-338 Promotes CNS Remyelination

Mol Ther , 2018 Dec 1; 27(2):411-423. Epub 2018 Dec 1

PubMed ID: 30611662 DOI: 10.1016/j.ymthe.2018.11.016

Did we miss your publication?

Have you published using AMAb91072? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch