Enhanced Validation

Anti-CDH1 Antibody

cadherin 1, type 1, E-cadherin (epithelial)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human CDH1
Alternative Gene Names
CD324, UVO, uvomorulin
Price
$437.00
Product Number
AMAb90865
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
cadherin 1, type 1, E-cadherin (epithelial)
Target gene
CDH1
Belongs to Antibody panel
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Epitope
Binds to an epitope located within the peptide sequence LKPKMALEVG as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020151 (80%)

Mouse ENSMUSG00000000303 (76%)

Clonality
Monoclonal
Clone ID
CL1180
Isotype
IgG2a
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
cadherin 1, type 1, E-cadherin (epithelial)
Gene Name
CDH1
Alternative Gene Names
CD324, UVO, uvomorulin
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature.
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Did we miss your publication?

Have you published using AMAb90865? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch