Enhanced Validation

Anti-CD163 Antibody

Cd163 molecule
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Monoclonal Antibody against Human CD163
Alternative Gene Names
M130, MM130, SCARI1
Price
$195.00
Product Number
AMAb91648
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
Cd163 molecule
Target Gene
CD163
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD
Epitope
Binds to an epitope located within the peptide sequence KGFGHIWLDS as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Clonality
Monoclonal
Clone ID
CL10658
Isotype
IgG1
Host
Mouse
Buffer
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Protein A purified
Notes
The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
25 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
Cd163 molecule
Gene Name
CD163
Alternative Gene Names
M130, MM130, SCARI1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Did we miss your publication?

Have you published using AMAb91648? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch