Enhanced Validation

Anti-ATAD2 Antibody

ATPase family, AAA domain containing 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human ATAD2
Alternative Gene Names
DKFZp667N1320, MGC29843, MGC5254, PRO2000
Price
$437.00
Product Number
AMAb90541
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
ATPase family, AAA domain containing 2
Target gene
ATAD2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Epitope
Binds to an epitope located within the peptide sequence VGDKRSDPEQ as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022360 (82%)

Rat ENSRNOG00000025604 (82%)

Clonality
Monoclonal
Clone ID
CL0182
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
ATPase family, AAA domain containing 2
Gene Name
ATAD2
Alternative Gene Names
DKFZp667N1320, MGC29843, MGC5254, PRO2000
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Liu N, Funasaka K, Obayashi T, Miyahara R, Hirooka Y, Goto H, Senga T

ATAD2 is associated with malignant characteristics of pancreatic cancer cells

Oncol Lett , 2019 Jan 23; 17(3):3489-3494. Epub 2019 Jan 23

PubMed ID: 30867788 DOI: 10.3892/ol.2019.9960

Wan WN, Zhang YX, Wang XM, Liu YJ, Zhang YQ, Que YH, Zhao WJ

ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.

Asian Pac J Cancer Prev , 2014; 15(6):2777-83

PubMed ID: 24761900 DOI: None

Did we miss your publication?

Have you published using AMAb90541? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch