Enhanced Validation

Anti-ADAR Antibody

adenosine deaminase, RNA-specific
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human ADAR
Alternative Gene Names
ADAR1, G1P1, IFI4
Price
$437.00
Product Number
AMAb90535
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
adenosine deaminase, RNA-specific
Target gene
ADAR
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027951 (86%)

Rat ENSRNOG00000020744 (85%)

Clonality
Monoclonal
Clone ID
CL0176
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
adenosine deaminase, RNA-specific
Gene Name
ADAR
Alternative Gene Names
ADAR1, G1P1, IFI4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Altadill T, Dowdy TM, Gill K, Reques A, Menon SS, Moiola CP, Lopez-Gil C, Coll E, Matias-Guiu X, Cabrera S, Garcia A, Reventos J, Byers SW, Gil-Moreno A, Cheema AK, Colas E

Metabolomic and Lipidomic Profiling Identifies The Role of the RNA Editing Pathway in Endometrial Carcinogenesis

Sci Rep , 2017 Aug 18; 7:8803. Epub 2017 Aug 18

PubMed ID: 28821813 DOI: 10.1038/s41598-017-09169-2

Anadón C, Guil S, Simó-Riudalbas L, Moutinho C, Setien F, Martínez-Cardús A, Moran S, Villanueva A, Calaf M, Vidal A, Lazo PA, Zondervan I, Savola S, Kohno T, Yokota J, Ribas de Pouplana L, Esteller M

Gene Amplification-Associated Overexpression of the RNA Editing Enzyme ADAR1 Enhances Human Lung Tumorigenesis

Oncogene , . Epub 2015 Dec 7

PubMed ID: 26640150 DOI: 10.1038/onc.2015.469

Did we miss your publication?

Have you published using AMAb90535? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch