QPrEST SG1D2 Mass Spectrometry Protein Standard

Secretoglobin family 1D member 2
Recommended Applications
Product Description
Stable isotope-labeled standard for absolute protein quantification of SG1D2.
Lys, Arg 13C and 15N metabolically labeled recombinant protein fragment.
Alternative Gene Names
Lipophilin-B
Price
$790.00
Product Number
QPrEST22371
Unit Size
≥ 1 nmol
Concentration
≥5µM
Availability
On Demand
Ships
ETA 6 weeks
Estimated shipping date is November 28th.
Target protein
Secretoglobin family 1D member 2
Target gene
SCGB1D2
Sequence With Theoretical Tryptic Peptides
FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
External Data for Theoretical Tryptic Peptides
FDAPPEAVAAK
SLIAEVLVK
Fusion Tag
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G
Expression Host
E. coli LysA ArgA BL21(DE3)
Purification method
IMAC purification
Notes
Gently mix before use. Avoid repeated freeze-thaw cycles.
Purity
≥90% as determined by Bioanalyzer Protein 230 Purity Assay
Theoretical MW
25 kDa including tags
Isotopic Incorporation
>99%
Unit Size
≥ 1 nmol supplied in 2 aliquotes
Concentration
≥5µM
Concentration Determination
Concentration determined by LC-MS/MS using a highly pure and amino acid analyzed QTag as internal standard for targeted quantification of the heavy labeled QPrEST. (CV%<10)
Formulation
Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0
Instructions for Reconstitution
Spin vial before opening. Add 100 μL distilled H2O to the vial and vortex for 30 seconds. Spin down. For further dilution see Application Protocol.
Unit Size
≥ 1 nmol
Current Lot
Produced on demand. Estimated shipping date is 6 weeks after placed order. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Absolute Quantification of protein using Mass Spectrometry
Protocols
Produced On Demand. Validation data not established.
Protein Name
Secretoglobin family 1D member 2
Alternative Protein Names
Lipophilin-B
Gene Name
SCGB1D2
Alternative Gene Names
Lipophilin-B
UniProt ID
Shipping
Shipped at ambient temperature
Storage
Lyophilized product should be stored at -20°C for up to 1 year.

Did we miss your publication?

Have you published using QPrEST22371? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch