QPrEST KTU Mass Spectrometry Protein Standard

Protein kintoun
Recommended Applications
Product Description
Stable isotope-labeled standard for absolute protein quantification of KTU.
Lys, Arg ¹³C and ¹⁵N metabolically labeled recombinant protein fragment.
Alternative Gene Names
Dynein assembly factor 2, axonemal
Price
$805.00
Product Number
QPrEST37464
Unit Size
≥1 nmol
Concentration
≥5 µM
Availability
On Demand
Ships
ETA 6 weeks
Target Protein
Protein kintoun
Target Gene
DNAAF2
Sequence with Theoretical Peptides
GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE
External Data for Theoretical Tryptic Peptides
ETLTLLIQVPR
IQPQSLQGDLNPLWYK
FSAQDLVYSFFLQFAPENK
LSTTEPVISISSNNAVIELAK
SPESHGHWR
Fusion Tag
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G
Expression Host
E. coli LysA ArgA BL21(DE3)
Purification Method
IMAC purification
Purity
≥90% as determined by Bioanalyzer Protein 230 Purity Assay
Theoretical MW
30 kDa including tags
Isotopic Incorporation
>99%
Unit Size
≥1 nmol supplied in 2 aliquotes
Concentration
≥5 µM
Concentration Determination
Concentration determined by LC-MS/MS using a highly pure, amino acid analyzed internal reference standard (Qtag), CV≤10%.
Formulation
Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0
Instructions for Reconstitution
Spin vial before opening. Add 100 μL ultrapure H₂O to the vial. Vortex thoroughly and spin down. For further dilution see Application Protocol. Material Safety Data Sheet
Unit Size
≥1 nmol
Current Lot
Produced on demand. Estimated shipping date is 6 weeks after placed order. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Absolute Quantification of protein using Mass Spectrometry
Protocols
Produced On Demand. Finished product is subjected to quality control to ensure compliance with product specifications.

For peptide data, see links to external databases.
Protein Name
Protein kintoun
Alternative Protein Names
Dynein assembly factor 2, axonemal
Gene Name
DNAAF2
Alternative Gene Names
Dynein assembly factor 2, axonemal
UniProt ID
Shipping
Shipped at ambient temperature
Storage
Lyophilized product should be stored at -20°C. Product can be stored for up to 1 year after production date.<br><br>Reconstituted product can be stored at -20°C for up to 4 weeks.

Did we miss your publication?

Have you published using QPrEST37464? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch