QPrEST BKRB2 Mass Spectrometry Protein Standard
B2 bradykinin receptor
Recommended Applications
Product Description
Stable isotope-labeled standard for absolute protein quantification of BKRB2.
Lys, Arg 13C and 15N metabolically labeled recombinant protein fragment.
Lys, Arg 13C and 15N metabolically labeled recombinant protein fragment.
Price
$790.00
Product Number
QPrEST24033
Unit Size
≥ 1 nmol
Concentration
≥5µM
Availability
On Demand
Ships
ETA 6 weeks

Recommended for absolute quantification of protein using Mass Spectrometry
Target protein
B2 bradykinin receptor
Target gene
BDKRB2
Sequence With Theoretical Tryptic Peptides
FSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQP
External Data for Theoretical Tryptic Peptides
ISMFLSVR
EDSVPTTASFSADMLNVTLQGPTLNGTFAQSK
Fusion Tag
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G
Expression Host
E. coli LysA ArgA BL21(DE3)
Purification method
IMAC purification
Notes
Gently mix before use. Avoid repeated freeze-thaw cycles.
Purity
≥90% as determined by Bioanalyzer Protein 230 Purity Assay
Theoretical MW
24 kDa including tags
Isotopic Incorporation
>99%
Unit Size
≥ 1 nmol supplied in 2 aliquotes
Concentration
≥5µM
Concentration Determination
Concentration determined by LC-MS/MS using a highly pure and amino acid analyzed QTag as internal standard for targeted quantification of the heavy labeled QPrEST. (CV%<10)
Formulation
Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0
Instructions for Reconstitution
Spin vial before opening. Add 100 μL distilled H2O to the vial and vortex for 30 seconds. Spin down. For further dilution see Application Protocol.
Unit Size
≥ 1 nmol
Current Lot
Produced on demand. Estimated shipping date is 6 weeks after placed order. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Absolute Quantification of protein using Mass Spectrometry
Protocols
Produced On Demand. Validation data not established.
Shipping
Shipped at ambient temperature
Storage
Lyophilized product should be stored at -20°C for up to 1 year.
Did we miss your publication?
Have you published using QPrEST24033? Please let us know and we will be happy to include your reference on this page.
Join the Explorer Program
Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.
Questions?
Our customer support and expert scientific support teams are here to help you succeed in your research.