PrEST Antigen USP46

ubiquitin specific peptidase 46
Product Description
Recombinant protein fragment of Human USP46
Alternative Gene Names
FLJ12552
Price
$230.00
Product Number
APrEST70798
Unit Size
100 µl
Concentration
≥0.5 mg/ml
Availability
5 in Stock
Ships
Ready to Ship
Target Protein
ubiquitin specific peptidase 46
Target Gene
USP46
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000054814 (100%)

Rat ENSRNOG00000002106 (99%)

Amino Acid Sequence
LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
Fusion Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Expression Host
E. coli
Buffer
PBS and 1M Urea, pH 7.4. Material Safety Data Sheet
Purification Method
IMAC purification
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Theoretical MW
29 kDa including tags
Concentration
≥0.5 mg/ml
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Blocking agent and positive assay control using corresponding antibodies.
Protocols
Produced On Demand. Validation data not established.
Protein Name
ubiquitin specific peptidase 46
Gene Name
USP46
Alternative Gene Names
FLJ12552
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Shipped in liquid form on wet ice.
Storage
Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Did we miss your publication?

Have you published using APrEST70798? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch