PrEST Antigen KIAA0922

KIAA0922
Product Description
Recombinant protein fragment of Human KIAA0922
Alternative Gene Names
DKFZp586H1322, TMEM131L
Price
$224.00
Product Number
APrEST84003
Unit Size
100 µl
Concentration
≥0.5 mg/ml
Availability
10 in Stock
Ships
Ready to Ship
Target protein
KIAA0922
Target gene
KIAA0922
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000033767 (71%)

Rat ENSRNOG00000009837 (69%)

Amino Acid Sequence
LNCTLENGVPCVIQESAPVHNSFIDWSATCEGQFSSAYCPLELNDYNAFPEENMNYANGFPCPADVQTDFIDHNSQSTWNTPPNMPAAWGHASFISSP
Fusion Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Expression Host
E. coli
Buffer
PBS and 1M Urea, pH 7.4. Material Safety Data Sheet
Purification method
IMAC chromatography
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Theoretical MW
28 kDa including tags
Concentration
≥0.5 mg/ml
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Blocking agent and positive assay control using corresponding antibodies.
Protocols
Produced On Demand. Validation data not established.
Protein Name
KIAA0922
Gene Name
KIAA0922
Alternative Gene Names
DKFZp586H1322, TMEM131L
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Shipped in liquid form on wet ice.
Storage
Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Did we miss your publication?

Have you published using APrEST84003? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antibody Products

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch