PrEST Antigen DDX3X

DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
Product Description
Recombinant protein fragment of Human DDX3X
Alternative Gene Names
DBX, DDX14, DDX3, HLP2
Price
$240.00
Product Number
APrEST74302
Unit Size
100 µl
Concentration
≥0.5 mg/ml
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
Target Gene
DDX3X
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000023383 (97%)

Mouse ENSMUSG00000000787 (97%)

Amino Acid Sequence
LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Fusion Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Expression Host
E. coli
Buffer
PBS and 1M Urea, pH 7.4. Material Safety Data Sheet
Purification Method
IMAC purification
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Theoretical MW
34 kDa including tags
Concentration
≥0.5 mg/ml
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Blocking agent and positive assay control using corresponding antibodies.
Protocols
Produced On Demand. Validation data not established.
Protein Name
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
Gene Name
DDX3X
Alternative Gene Names
DBX, DDX14, DDX3, HLP2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Shipped in liquid form on wet ice.
Storage
Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Did we miss your publication?

Have you published using APrEST74302? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antibody Products

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch