PrEST Antigen DCAF12L2

DDB1 and CUL4 associated factor 12-like 2
Product Description
Recombinant protein fragment of Human DCAF12L2
Alternative Gene Names
WDR40C
Price
$230.00
Product Number
APrEST82926
Unit Size
100 µl
Concentration
≥0.5 mg/ml
Availability
On Demand
Ships
On Demand
Target Protein
DDB1 and CUL4 associated factor 12-like 2
Target Gene
DCAF12L2
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000023458 (77%)

Mouse ENSMUSG00000045284 (77%)

Amino Acid Sequence
SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL
Fusion Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Expression Host
E. coli
Buffer
PBS and 1M Urea, pH 7.4. Material Safety Data Sheet
Purification Method
IMAC purification
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Theoretical MW
22 kDa including tags
Concentration
≥0.5 mg/ml
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Blocking agent and positive assay control using corresponding antibodies.
Protocols
Produced On Demand. Validation data not established.
Protein Name
DDB1 and CUL4 associated factor 12-like 2
Gene Name
DCAF12L2
Alternative Gene Names
WDR40C
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Shipped in liquid form on wet ice.
Storage
Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Did we miss your publication?

Have you published using APrEST82926? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antibody Products

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch