Enhanced Validation

Polyclonal Anti-ZYX Antibody

zyxin
References (8)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ZYX
Open Datasheet
Price
$505.00
Product Number
HPA004835
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human endometrium and liver tissues using HPA004835 antibody. Corresponding ZYX RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to focal adhesion sites.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
zyxin
Target Gene
ZYX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017354 (85%)

Mouse ENSMUSG00000029860 (84%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA004835 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA004835 on the Human Protein Atlas
Protein Name
zyxin
Gene Name
ZYX
UniProt ID
Q15942
Gene (Ensembl)
ENSG00000159840
Entrez Gene ID
Entrez gene: 7791
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000159840 on the Human Protein Atlas

Sporkova A, Ghosh S, Al-Hasani J, Hecker M

Lin11-Isl1-Mec3 Domain Proteins as Mechanotransducers in Endothelial and Vascular Smooth Muscle Cells

Front Physiol , 2021 Nov 19; 12:769321. Epub 2021 Nov 19

PubMed ID: 34867475 DOI: 10.3389/fphys.2021.769321

van Gaal RC, Ippel BD, Spaans S, Komil MI, Dankers PY

Effectiveness of cell adhesive additives in different supramolecular polymers

J Polym Sci (2020) , 2021 Mar 29; 59(12):1253-1266. Epub 2021 Mar 29

PubMed ID: 34263178 DOI: 10.1002/pol.20210073

Jain PB, Guerreiro PS, Canato S, Janody F

The spectraplakin Dystonin antagonizes YAP activity and suppresses tumourigenesis

Sci Rep , 2019 Dec 27; 9:19843. Epub 2019 Dec 27

PubMed ID: 31882643 DOI: 10.1038/s41598-019-56296-z

Schell C, Sabass B, Helmstaedter M, Geist F, Abed A, Yasuda-Yamahara M, Sigle A, Maier JI, Grahammer F, Siegerist F, Artelt N, Endlich N, Kerjaschki D, Arnold HH, Dengjel J, Rogg M, Huber TB

ARP3 Controls the Podocyte Architecture at the Kidney Filtration Barrier

Dev Cell , 2018 Dec 17; 47(6):741-757.e8

PubMed ID: 30503751 DOI: 10.1016/j.devcel.2018.11.011

Fukumoto M, Ijuin T, Takenawa T

PI(3,4)P2 plays critical roles in the regulation of focal adhesion dynamics of MDA‐MB‐231 breast cancer cells

Cancer Sci , 2017 May 11; 108(5):941-951. Epub 2017 May 11

PubMed ID: 28247964 DOI: 10.1111/cas.13215

Harrington KM, Clevenger CV

Identification of NEK3 Kinase Threonine 165 as a Novel Regulatory Phosphorylation Site That Modulates Focal Adhesion Remodeling Necessary for Breast Cancer Cell Migration

J Biol Chem , 2016 Aug 3; 291(41):21388-21406. Epub 2016 Aug 3

PubMed ID: 27489110 DOI: 10.1074/jbc.M116.726190

Fukumoto M, Kurisu S, Yamada T, Takenawa T

α-Actinin-4 Enhances Colorectal Cancer Cell Invasion by Suppressing Focal Adhesion Maturation

PLoS One , 2015; 10(4):e0120616. Epub 2015 Apr 10

PubMed ID: 25860875 DOI: 10.1371/journal.pone.0120616

Did we miss your publication?

Have you published using HPA004835? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-ZYX (AMAb90992)
Anti-ZYX (HPA073497)
Corresponding Antigens
PrEST Antigen ZYX (APrEST86861)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch