Enhanced Validation

Anti-ZNF207 Antibody

zinc finger protein 207
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ZNF207
Price
$445.00
Product Number
HPA017013
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
zinc finger protein 207
Target Gene
ZNF207
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000236 (99%)

Mouse ENSMUSG00000017421 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-ZNF207 HPA063908.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
zinc finger protein 207
Gene Name
ZNF207
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000010244 on the Human Protein Atlas

Huang Y, Li T, Ems-McClung SC, Walczak CE, Prigent C, Zhu X, Zhang X, Zheng Y

Aurora A activation in mitosis promoted by BuGZ

J Cell Biol , 2018 Jan 2; 217(1):107-116

PubMed ID: 29074706 DOI: 10.1083/jcb.201706103

Wan Y, Zheng X, Chen H, Guo Y, Jiang H, He X, Zhu X, Zheng Y

Splicing function of mitotic regulators links R-loop–mediated DNA damage to tumor cell killing

J Cell Biol , 2015 Apr 27; 209(2):235-246

PubMed ID: 25918225 DOI: 10.1083/jcb.201409073

Did we miss your publication?

Have you published using HPA017013? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch