Polyclonal Anti-XK Antibody

X-linked Kx blood group
References (3)
Recommended Applications
Product Description
Polyclonal Antibody against Human XK
Alternative Gene Names
Kx, NA, NAC, X1k, XKR1
Open Datasheet
Price
$459.00
Product Number
HPA019036
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
X-linked Kx blood group
Target Gene
XK
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000015342 (89%)

Rat ENSRNOG00000003749 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
X-linked Kx blood group
Gene Name
XK
Alternative Gene Names
Kx, NA, NAC, X1k, XKR1
UniProt ID
P51811
Gene (Ensembl)
ENSG00000047597
Entrez Gene ID
Entrez gene: 7504
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000047597 on the Human Protein Atlas

Park JS, Neiman AM

XK is a partner for VPS13A: a molecular link between Chorea-Acanthocytosis and McLeod Syndrome

Mol Biol Cell , 2020 Oct 15; 31(22):2425-2436

PubMed ID: 32845802 DOI: 10.1091/mbc.E19-08-0439-T

Urata Y, Nakamura M, Sasaki N, Shiokawa N, Nishida Y, Arai K, Hiwatashi H, Yokoyama I, Narumi S, Terayama Y, Murakami T, Ugawa Y, Sakamoto H, Kaneko S, Nakazawa Y, Yamasaki R, Sadashima S, Sakai T, Arai H, Sano A

Novel pathogenic XK mutations in McLeod syndrome and interaction between XK protein and chorein

Neurol Genet , 2019 Apr 22; 5(3):e328. Epub 2019 Apr 22

PubMed ID: 31086825 DOI: 10.1212/NXG.0000000000000328

Did we miss your publication?

Have you published using HPA019036? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen XK (APrEST74335)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch