Enhanced Validation

Anti-WWTR1 Antibody

WW domain containing transcription regulator 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human WWTR1
Alternative Gene Names
DKFZp586I1419, TAZ
Price
$445.00
Product Number
HPA007415
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
WW domain containing transcription regulator 1
Target Gene
WWTR1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016617 (96%)

Mouse ENSMUSG00000027803 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
WW domain containing transcription regulator 1
Gene Name
WWTR1
Alternative Gene Names
DKFZp586I1419, TAZ
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000018408 on the Human Protein Atlas

Isfort I, Elges S, Cyra M, Berthold R, Renner M, Mechtersheimer G, Åman P, Larsson O, Ratner N, Hafner S, Simmet T, Schliemann C, Rossig C, Dirksen U, Grünewald I, Wardelmann E, Huss S, Hartmann W, Trautmann M

Prevalence of the Hippo Effectors YAP1/TAZ in Tumors of Soft Tissue and Bone

Sci Rep , 2019 Dec 23; 9:19704. Epub 2019 Dec 23

PubMed ID: 31873172 DOI: 10.1038/s41598-019-56247-8

Lodge EJ, Santambrogio A, Russell JP, Xekouki P, Jacques TS, Johnson RL, Thavaraj S, Bornstein SR, Andoniadou CL

Homeostatic and tumourigenic activity of SOX2+ pituitary stem cells is controlled by the LATS/YAP/TAZ cascade

eLife , 2019 Mar 26; 8:e43996. Epub 2019 Mar 26

PubMed ID: 30912742 DOI: 10.7554/eLife.43996

Kim YH, Choi J, Yang MJ, Hong SP, Lee CK, Kubota Y, Lim DS, Koh GY

A MST1–FOXO1 cascade establishes endothelial tip cell polarity and facilitates sprouting angiogenesis

Nat Commun , 2019 Feb 19; 10:838. Epub 2019 Feb 19

PubMed ID: 30783090 DOI: 10.1038/s41467-019-08773-2

Hwang JH, Kim AR, Kim KM, Il Park J, Oh HT, Moon SA, Byun MR, Jeong H, Kim HK, Yaffe MB, Hwang ES, Hong JH

TAZ couples Hippo/Wnt signalling and insulin sensitivity through Irs1 expression

Nat Commun , 2019 Jan 24; 10:421. Epub 2019 Jan 24

PubMed ID: 30679431 DOI: 10.1038/s41467-019-08287-x

Volckaert T, Yuan T, Yuan J, Boateng E, Hopkins S, Zhang JS, Thannickal VJ, Fässler R, De Langhe SP

Hippo signaling promotes lung epithelial lineage commitment by curbing Fgf10 and β-catenin signaling

Development , 2019 Jan 16; 146(2):dev166454. Epub 2019 Jan 16

PubMed ID: 30651296 DOI: 10.1242/dev.166454

LeBlanc L, Lee BK, Yu AC, Kim M, Kambhampati AV, Dupont SM, Seruggia D, Ryu BU, Orkin SH, Kim J

Yap1 safeguards mouse embryonic stem cells from excessive apoptosis during differentiation

eLife , 2018 Dec 18; 7:e40167. Epub 2018 Dec 18

PubMed ID: 30561326 DOI: 10.7554/eLife.40167

Li N, Feng Y, Hu Y, He C, Xie C, Ouyang Y, Artim SC, Huang D, Zhu Y, Luo Z, Ge Z, Lu N

Helicobacter pylori CagA promotes epithelial mesenchymal transition in gastric carcinogenesis via triggering oncogenic YAP pathway

J Exp Clin Cancer Res , 2018 Nov 22; 37:280. Epub 2018 Nov 22

PubMed ID: 30466467 DOI: 10.1186/s13046-018-0962-5

Luu AK, Schott CR, Jones R, Poon AC, Golding B, Hamed R, Deheshi B, Mutsaers A, Wood GA, Viloria-Petit AM

An evaluation of TAZ and YAP crosstalk with TGFβ signalling in canine osteosarcoma suggests involvement of hippo signalling in disease progression

BMC Vet Res , 2018 Nov 26; 14:365. Epub 2018 Nov 26

PubMed ID: 30477496 DOI: 10.1186/s12917-018-1651-5

Lu Y, Maruyama J, Kuwata K, Fukuda H, Iwasa H, Arimoto-Matsuzaki K, Sugimura H, Hata Y

Doublecortin-like kinase 1 compromises DNA repair and induces chromosomal instability

Biochem Biophys Rep , 2018 Oct 30; 16:130-137. Epub 2018 Oct 30

PubMed ID: 30417131 DOI: 10.1016/j.bbrep.2018.10.014

Mohamed AD, Shah N, Hettmer S, Vargesson N, Wackerhage H

Analysis of the relationship between the KRAS G12V oncogene and the Hippo effector YAP1 in embryonal rhabdomyosarcoma

Sci Rep , 2018 Oct 23; 8:15674. Epub 2018 Oct 23

PubMed ID: 30353028 DOI: 10.1038/s41598-018-33852-7

Eales KL, Wilkinson EA, Cruickshank G, Tucker JH, Tennant DA

Verteporfin selectively kills hypoxic glioma cells through iron-binding and increased production of reactive oxygen species

Sci Rep , 2018 Sep 25; 8:14358. Epub 2018 Sep 25

PubMed ID: 30254296 DOI: 10.1038/s41598-018-32727-1

Merritt NM, Fullenkamp CA, Hall SL, Qian Q, Desai C, Thomason J, Lambertz AM, Dupuy AJ, Darbro B, Tanas MR

A comprehensive evaluation of Hippo pathway silencing in sarcomas

Oncotarget , 2018 Aug 3; 9(60):31620-31636. Epub 2018 Aug 3

PubMed ID: 30167083 DOI: 10.18632/oncotarget.25824

Xekouki P, Lodge EJ, Matschke J, Santambrogio A, Apps JR, Sharif A, Jacques TS, Aylwin S, Prevot V, Li R, Flitsch J, Bornstein SR, Theodoropoulou M, Andoniadou CL

Non-secreting pituitary tumours characterised by enhanced expression of YAP/TAZ

Endocr Relat Cancer , 2018 Aug 21; 26(1):215-225. Epub 2018 Aug 21

PubMed ID: 30139767 DOI: 10.1530/ERC-18-0330

Han H, Yang B, Nakaoka HJ, Yang J, Zhao Y, Le Nguyen K, Bishara AT, Mandalia TK, Wang W

Hippo signaling dysfunction induces cancer cell addiction to YAP

Oncogene , 2018 Aug 1; 37(50):6414-6424. Epub 2018 Aug 1

PubMed ID: 30068939 DOI: 10.1038/s41388-018-0419-5

Kato K, Diéguez-Hurtado R, Park DY, Hong SP, Kato-Azuma S, Adams S, Stehling M, Trappmann B, Wrana JL, Koh GY, Adams RH

Pulmonary pericytes regulate lung morphogenesis

Nat Commun , 2018 Jun 22; 9:2448. Epub 2018 Jun 22

PubMed ID: 29934496 DOI: 10.1038/s41467-018-04913-2

Deel MD, Slemmons KK, Hinson AR, Genadry KC, Burgess BA, Crose LE, Kuprasertkul N, Oristian KM, Bentley RC, Linardic CM

The transcriptional co-activator TAZ is a potent mediator of alveolar rhabdomyosarcoma tumorigenesis

Clin Cancer Res , 2018 Mar 7; 24(11):2616-2630. Epub 2018 Mar 7

PubMed ID: 29514840 DOI: 10.1158/1078-0432.CCR-17-1207

Neto F, Klaus-Bergmann A, Ong YT, Alt S, Vion AC, Szymborska A, Carvalho JR, Hollfinger I, Bartels-Klein E, Franco CA, Potente M, Gerhardt H

YAP and TAZ regulate adherens junction dynamics and endothelial cell distribution during vascular development

eLife , 2018 Feb 5; 7:e31037. Epub 2018 Feb 5

PubMed ID: 29400648 DOI: 10.7554/eLife.31037

Jeong SH, Kim HB, Kim MC, Lee JM, Lee JH, Kim JH, Kim JW, Park WY, Kim SY, Kim JB, Kim H, Kim JM, Choi HS, Lim DS

Hippo-mediated suppression of IRS2/AKT signaling prevents hepatic steatosis and liver cancer

J Clin Invest , 2018 Feb 5; 128(3):1010-1025. Epub 2018 Feb 5

PubMed ID: 29400692 DOI: 10.1172/JCI95802

Konishi T, Schuster RM, Lentsch AB

Proliferation of hepatic stellate cells, mediated by YAP and TAZ, contributes to liver repair and regeneration after liver ischemia-reperfusion injury

Am J Physiol Gastrointest Liver Physiol , 2018 Jan 11; 314(4):G471-G482. Epub 2018 Jan 11

PubMed ID: 29351389 DOI: 10.1152/ajpgi.00153.2017

Hagiyama M, Yabuta N, Okuzaki D, Inoue T, Takashima Y, Kimura R, Ri A, Ito A

Modest Static Pressure Suppresses Columnar Epithelial Cell Growth in Association with Cell Shape and Cytoskeletal Modifications

Front Physiol , 2017 Dec 5; 8:997. Epub 2017 Dec 5

PubMed ID: 29259558 DOI: 10.3389/fphys.2017.00997

Ingallina E, Sorrentino G, Bertolio R, Lisek K, Zannini A, Azzolin L, Severino LU, Scaini D, Mano M, Mantovani F, Rosato A, Bicciato S, Piccolo S, Del Sal G

Mechanical cues control mutant p53 stability through a Mevalonate/RhoA axis

Nat Cell Biol , 2017 Dec 18; 20(1):28-35. Epub 2017 Dec 18

PubMed ID: 29255172 DOI: 10.1038/s41556-017-0009-8

Mayoral-Varo V, Calcabrini A, Sánchez-Bailón MP, Martín-Pérez J

miR205 inhibits stem cell renewal in SUM159PT breast cancer cells

PLoS One , 2017 Nov 28; 12(11):e0188637. Epub 2017 Nov 28

PubMed ID: 29182685 DOI: 10.1371/journal.pone.0188637

Levasseur A, St-Jean G, Paquet M, Boerboom D, Boyer A

Targeted Disruption of YAP and TAZ Impairs the Maintenance of the Adrenal Cortex

Endocrinology , 2017 Sep 14; 158(11):3738-3753. Epub 2017 Sep 14

PubMed ID: 28938438 DOI: 10.1210/en.2017-00098

Sun C, De Mello V, Mohamed A, Ortuste Quiroga HP, Garcia‐Munoz A, Al Bloshi A, Tremblay AM, von Kriegsheim A, Collie‐Duguid E, Vargesson N, Matallanas D, Wackerhage H, Zammit PS

Common and Distinctive Functions of the Hippo Effectors Taz and Yap in Skeletal Muscle Stem Cell Function

Stem Cells , 2017 Jun 27; 35(8):1958-1972. Epub 2017 Jun 27

PubMed ID: 28589555 DOI: 10.1002/stem.2652

Diamantopoulou Z, White G, Fadlullah MZ, Dreger M, Pickering K, Maltas J, Ashton G, MacLeod R, Baillie GS, Kouskoff V, Lacaud G, Murray GI, Sansom OJ, Hurlstone AF, Malliri A

TIAM1 Antagonizes TAZ/YAP Both in the Destruction Complex in the Cytoplasm and in the Nucleus to Inhibit Invasion of Intestinal Epithelial Cells

Cancer Cell , 2017 May 8; 31(5):621-634.e6

PubMed ID: 28416184 DOI: 10.1016/j.ccell.2017.03.007

Deng Y, Wu LM, Bai S, Zhao C, Wang H, Wang J, Xu L, Sakabe M, Zhou W, Xin M, Lu QR

A reciprocal regulatory loop between TAZ/YAP and G-protein Gαs regulates Schwann cell proliferation and myelination

Nat Commun , 2017 Apr 26; 8:15161. Epub 2017 Apr 26

PubMed ID: 28443644 DOI: 10.1038/ncomms15161

Liu CY, Yu T, Huang Y, Cui L, Hong W

ETS (E26 transformation-specific) up-regulation of the transcriptional co-activator TAZ promotes cell migration and metastasis in prostate cancer

J Biol Chem , 2017 Apr 13; 292(22):9420-9430. Epub 2017 Apr 13

PubMed ID: 28408625 DOI: 10.1074/jbc.M117.783787

Wang Z, Liu P, Zhou X, Wang T, Feng X, Sun YP, Xiong Y, Yuan HX, Guan KL

Endothelin Promotes Colorectal Tumorigenesis by Activating YAP/TAZ

Cancer Res , 2017 Mar 1; 77(9):2413-2423. Epub 2017 Mar 1

PubMed ID: 28249901 DOI: 10.1158/0008-5472.CAN-16-3229

Noguchi S, Saito A, Mikami Y, Urushiyama H, Horie M, Matsuzaki H, Takeshima H, Makita K, Miyashita N, Mitani A, Jo T, Yamauchi Y, Terasaki Y, Nagase T

TAZ contributes to pulmonary fibrosis by activating profibrotic functions of lung fibroblasts

Sci Rep , 2017 Feb 14; 7:42595. Epub 2017 Feb 14

PubMed ID: 28195168 DOI: 10.1038/srep42595

Sorrentino G, Ruggeri N, Zannini A, Ingallina E, Bertolio R, Marotta C, Neri C, Cappuzzello E, Forcato M, Rosato A, Mano M, Bicciato S, Del Sal G

Glucocorticoid receptor signalling activates YAP in breast cancer

Nat Commun , 2017 Jan 19; 8:14073. Epub 2017 Jan 19

PubMed ID: 28102225 DOI: 10.1038/ncomms14073

Lo Sardo F, Forcato M, Sacconi A, Capaci V, Zanconato F, Di Agostino S, Del Sal G, Pandolfi PP, Strano S, Bicciato S, Blandino G

MCM7 and its hosted miR-25, 93 and 106b cluster elicit YAP/TAZ oncogenic activity in lung cancer

Carcinogenesis , 2016 Nov 21; 38(1):64-75. Epub 2016 Nov 21

PubMed ID: 27797825 DOI: 10.1093/carcin/bgw110

Gruber R, Panayiotou R, Nye E, Spencer-Dene B, Stamp G, Behrens A

YAP1 and TAZ Control Pancreatic Cancer Initiation in Mice by Direct Up-regulation of JAK–STAT3 Signaling

Gastroenterology , 2016 Sep; 151(3):526-539

PubMed ID: 27215660 DOI: 10.1053/j.gastro.2016.05.006

Mohamed A, Sun C, De Mello V, Selfe J, Missiaglia E, Shipley J, Murray GI, Zammit PS, Wackerhage H

The Hippo effector TAZ (WWTR1) transforms myoblasts and TAZ abundance is associated with reduced survival in embryonal rhabdomyosarcoma

J Pathol , 2016 Aug 22; 240(1):3-14. Epub 2016 Aug 22

PubMed ID: 27184927 DOI: 10.1002/path.4745

Feng X, Liu P, Zhou X, Li MT, Li FL, Wang Z, Meng Z, Sun YP, Yu Y, Xiong Y, Yuan HX, Guan KL

Thromboxane A2 Activates YAP/TAZ Protein to Induce Vascular Smooth Muscle Cell Proliferation and Migration

J Biol Chem , 2016 Jul 5; 291(36):18947-18958. Epub 2016 Jul 5

PubMed ID: 27382053 DOI: 10.1074/jbc.M116.739722

Fullenkamp CA, Hall SL, Jaber OI, Pakalniskis BL, Savage EC, Savage JM, Ofori-Amanfo GK, Lambertz AM, Ivins SD, Stipp CS, Miller BJ, Milhem MM, Tanas MR

TAZ and YAP are frequently activated oncoproteins in sarcomas

Oncotarget , 2016 Apr 25; 7(21):30094-30108. Epub 2016 Apr 25

PubMed ID: 27129148 DOI: 10.18632/oncotarget.8979

Lodge EJ, Russell JP, Patist AL, Francis-West P, Andoniadou CL

Expression Analysis of the Hippo Cascade Indicates a Role in Pituitary Stem Cell Development

Front Physiol , 2016 Mar 31; 7:114. Epub 2016 Mar 31

PubMed ID: 27065882 DOI: 10.3389/fphys.2016.00114

Di Agostino S, Sorrentino G, Ingallina E, Valenti F, Ferraiuolo M, Bicciato S, Piazza S, Strano S, Del Sal G, Blandino G

YAP enhances the pro‐proliferative transcriptional activity of mutant p53 proteins

EMBO Rep , 2015 Dec 21; 17(2):188-201. Epub 2015 Dec 21

PubMed ID: 26691213 DOI: 10.15252/embr.201540488

Slemmons KK, Crose LE, Rudzinski E, Bentley RC, Linardic CM

Role of the YAP Oncoprotein in Priming Ras-Driven Rhabdomyosarcoma

PLoS One , 2015; 10(10):e0140781. Epub 2015 Oct 23

PubMed ID: 26496700 DOI: 10.1371/journal.pone.0140781

Liu F, Lagares D, Choi KM, Stopfer L, Marinković A, Vrbanac V, Probst CK, Hiemer SE, Sisson TH, Horowitz JC, Rosas IO, Fredenburgh LE, Feghali-Bostwick C, Varelas X, Tager AM, Tschumperlin DJ

Mechanosignaling through YAP and TAZ drives fibroblast activation and fibrosis

Am J Physiol Lung Cell Mol Physiol , 2015/02/15; 308(4):L344-L357. Epub 2014 Dec 12

PubMed ID: 25502501 DOI: 10.1152/ajplung.00300.2014

Sorrentino G, Ruggeri N, Specchia V, Cordenonsi M, Mano M, Dupont S, Manfrin A, Ingallina E, Sommaggio R, Piazza S, Rosato A, Piccolo S, Del Sal G

Metabolic control of YAP and TAZ by the mevalonate pathway.

Nat Cell Biol , 2014 Apr; 16(4):357-66. Epub 2014 Mar 23

PubMed ID: 24658687 DOI: 10.1038/ncb2936

Did we miss your publication?

Have you published using HPA007415? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch