Enhanced Validation

Anti-WIPI1 Antibody

WD repeat domain, phosphoinositide interacting 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human WIPI1
Alternative Gene Names
Atg18, ATG18A, FLJ10055, WIPI49
Price
$445.00
Product Number
HPA007493
Unit Size
Concentration
Lot dependent
Availability
1 in Stock
Ships
Ready to Ship
Target Protein
WD repeat domain, phosphoinositide interacting 1
Target Gene
WIPI1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000041895 (94%)

Rat ENSRNOG00000003827 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
WD repeat domain, phosphoinositide interacting 1
Gene Name
WIPI1
Alternative Gene Names
Atg18, ATG18A, FLJ10055, WIPI49
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000070540 on the Human Protein Atlas

Chakraborty D, Felzen V, Hiebel C, Stürner E, Perumal N, Manicam C, Sehn E, Grus F, Wolfrum U, Behl C

Enhanced autophagic-lysosomal activity and increased BAG3-mediated selective macroautophagy as adaptive response of neuronal cells to chronic oxidative stress

Redox Biol , 2019 Apr 2; 24:101181. Epub 2019 Apr 2

PubMed ID: 30959460 DOI: 10.1016/j.redox.2019.101181

D'Arcangelo D, Giampietri C, Muscio M, Scatozza F, Facchiano F, Facchiano A

WIPI1, BAG1, and PEX3 Autophagy-Related Genes Are Relevant Melanoma Markers

Oxid Med Cell Longev , 2018 Dec 2; 2018:1471682. Epub 2018 Dec 2

PubMed ID: 30622661 DOI: 10.1155/2018/1471682

Felzen V, Hiebel C, Koziollek-Drechsler I, Reißig S, Wolfrum U, Kögel D, Brandts C, Behl C, Morawe T

Estrogen receptor α regulates non-canonical autophagy that provides stress resistance to neuroblastoma and breast cancer cells and involves BAG3 function

Cell Death Dis , 2015 Jul 9; 6(7):e1812-. Epub 2015 Jul 9

PubMed ID: 26158518 DOI: 10.1038/cddis.2015.181

Did we miss your publication?

Have you published using HPA007493? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch