Enhanced Validation

Polyclonal Anti-WDR55 Antibody

WD repeat domain 55
References (1)
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human WDR55
Alternative Gene Names
FLJ20195, FLJ21702
Open Datasheet
Price
$505.00
Product Number
HPA043470
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Show all images
[1 pictures]
Western blot analysis in control (vector only transfected HEK293T lysate) and WDR55 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413614).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
WD repeat domain 55
Target Gene
WDR55
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGH
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017251 (93%)

Mouse ENSMUSG00000042660 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA043470 on the Human Protein Atlas
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
WD repeat domain 55
Gene Name
WDR55
Alternative Gene Names
FLJ20195, FLJ21702
UniProt ID
Q9H6Y2
Gene (Ensembl)
ENSG00000120314
Entrez Gene ID
Entrez gene: 54853
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000120314 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA043470? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-WDR55 (HPA048143)
Corresponding Antigens
PrEST Antigen WDR55 (APrEST84005)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch