Enhanced Validation

Anti-WDR13 Antibody

WD repeat domain 13
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human WDR13
Price
$445.00
Product Number
HPA000913
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
WD repeat domain 13
Target Gene
WDR13
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVLRVLR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000031166 (98%)

Rat ENSRNOG00000039587 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
WD repeat domain 13
Gene Name
WDR13
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101940 on the Human Protein Atlas

Singh VP, Katta S, Kumar S

WD-repeat protein WDR13 is a novel transcriptional regulator of c-Jun and modulates intestinal homeostasis in mice

BMC Cancer , 2017 Feb 21; 17:148. Epub 2017 Feb 21

PubMed ID: 28222755 DOI: 10.1186/s12885-017-3118-7

Mitra S, Sameer Kumar GS, Tiwari V, Lakshmi BJ, Thakur SS, Kumar S

Implication of Genetic Deletion of Wdr13 in Mice: Mild Anxiety, Better Performance in Spatial Memory Task, with Upregulation of Multiple Synaptic Proteins

Front Mol Neurosci , 2016 Aug 30; 9:73. Epub 2016 Aug 30

PubMed ID: 27625594 DOI: 10.3389/fnmol.2016.00073

Singh VP, Alex JL, Lakshmi BJ, Sailasree SP, Raj TA, Kumar S

Role of mouse Wdr13 in placental growth; a genetic evidence for lifetime body weight determination by placenta during development

Sci Rep , 2015 Aug 26; 5:13371. Epub 2015 Aug 26

PubMed ID: 26306915 DOI: 10.1038/srep13371

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Singh VP, Lakshmi BJ, Singh S, Shah V, Goel S, Sarathi DP, Kumar S

Lack of Wdr13 Gene in Mice Leads to Enhanced Pancreatic Beta Cell Proliferation, Hyperinsulinemia and Mild Obesity

PLoS One , 2012; 7(6):e38685. Epub 2012 Jun 8

PubMed ID: 22715406 DOI: 10.1371/journal.pone.0038685

Did we miss your publication?

Have you published using HPA000913? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch