Polyclonal Anti-VWF Antibody

von Willebrand factor
References (5)
Recommended Applications
Product Description
Polyclonal Antibody against Human VWF
Alternative Gene Names
F8VWF
Open Datasheet
Price
$505.00
Product Number
HPA001815
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human esophagus shows vessel positivity in squamous epithelial cells.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
von Willebrand factor
Target Gene
VWF
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001930 (80%)

Rat ENSRNOG00000019689 (80%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
von Willebrand factor
Gene Name
VWF
Alternative Gene Names
F8VWF
UniProt ID
P04275
Gene (Ensembl)
ENSG00000110799
Entrez Gene ID
Entrez gene: 7450
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000110799 on the Human Protein Atlas

Zhao Y, Li S, Quan E, Zhang H, Wu Y, Luo Y, Peng L, Wang J, Zhu J, Liu J

Trimetazidine inhibits cardiac fibrosis by reducing reactive oxygen species and downregulating connective tissue growth factor in streptozotocin-induced diabetic rats

Exp Ther Med , 2019 Jun 25; 18(2):1477-1485. Epub 2019 Jun 25

PubMed ID: 31363380 DOI: 10.3892/etm.2019.7705

LaBonty M, Pray N, Yelick PC

Injury of Adult Zebrafish Expressing Acvr1lQ204D Does Not Result in Heterotopic Ossification

Zebrafish , 2018 Nov 29; 15(6):536-545. Epub 2018 Nov 29

PubMed ID: 30183553 DOI: 10.1089/zeb.2018.1611

Hao F, Zhang F, Wu DD, An D, Shi J, Li G, Xu X, Cui MZ

Lysophosphatidic acid-induced vascular neointimal formation in mouse carotid arteries is mediated by the matricellular protein CCN1/Cyr61

Am J Physiol Cell Physiol , 2016 Oct 19; 311(6):C975-C984. Epub 2016 Oct 19

PubMed ID: 27760754 DOI: 10.1152/ajpcell.00227.2016

Bachmann J, Burté F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P

Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria

PLoS Pathog , 2014 Apr; 10(4):e1004038. Epub 2014 Apr 17

PubMed ID: 24743550 DOI: 10.1371/journal.ppat.1004038

Did we miss your publication?

Have you published using HPA001815? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-VWF (AMAb90928)
Anti-VWF (AMAb90931)
Anti-VWF (HPA002082)
Corresponding Antigens
PrEST Antigen VWF (APrEST83058)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch