Enhanced Validation

Polyclonal Anti-VASP Antibody

vasodilator-stimulated phosphoprotein
References (6)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human VASP
Open Datasheet
Price
$505.00
Product Number
HPA005724
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA005724 antibody. Corresponding VASP RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in human cell lines U-251MG and HEK293 using Anti-VASP antibody. Corresponding VASP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & focal adhesion sites.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
vasodilator-stimulated phosphoprotein
Target Gene
VASP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000030403 (85%)

Rat ENSRNOG00000016367 (82%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA005724 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA005724 on the Human Protein Atlas
Protein Name
vasodilator-stimulated phosphoprotein
Gene Name
VASP
UniProt ID
P50552
Gene (Ensembl)
ENSG00000125753
Entrez Gene ID
Entrez gene: 7408
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000125753 on the Human Protein Atlas

, . Epub 2023 Mar 3

PubMed ID: 36871754 DOI: 10.1016/j.jbc.2023.104571

Fäßler F, Javoor MG, Datler J, Döring H, Hofer FW, Dimchev G, Hodirnau VV, Faix J, Rottner K, Schur FK

ArpC5 isoforms regulate Arp2/3 complex–dependent protrusion through differential Ena/VASP positioning

Sci Adv , 2023 Jan 20; 9(3):eadd6495. Epub 2023 Jan 20

PubMed ID: 36662867 DOI: 10.1126/sciadv.add6495

Waldman MM, Rahkola JT, Sigler AL, Chung JW, Willett BA, Kedl RM, Friedman RS, Jacobelli J

Ena/VASP Protein-Mediated Actin Polymerization Contributes to Naïve CD8+ T Cell Activation and Expansion by Promoting T Cell–APC Interactions In Vivo

Front Immunol , 2022 Jun 9; 13:856977. Epub 2022 Jun 9

PubMed ID: 35757762 DOI: 10.3389/fimmu.2022.856977

Tojkander S, Gateva G, Husain A, Krishnan R, Lappalainen P

Generation of contractile actomyosin bundles depends on mechanosensitive actin filament assembly and disassembly

eLife , 2015 Dec 10; 4:e06126. Epub 2015 Dec 10

PubMed ID: 26652273 DOI: 10.7554/eLife.06126

Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E

Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.

J Proteomics , 2012 Apr 3; 75(7):2236-51. Epub 2012 Feb 15

PubMed ID: 22361696 DOI: 10.1016/j.jprot.2012.01.030

Did we miss your publication?

Have you published using HPA005724? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen VASP (APrEST70083)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch