Anti-UHRF2 Antibody

ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Recommended Applications
Product Description
Polyclonal Antibody against Human UHRF2
Alternative Gene Names
MGC33463, NIRF, RNF107, URF2
Price
$450.00
Product Number
HPA026633
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Target Gene
UHRF2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000011308 (81%)

Mouse ENSMUSG00000024817 (81%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Gene Name
UHRF2
Alternative Gene Names
MGC33463, NIRF, RNF107, URF2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000147854 on the Human Protein Atlas

Lu H, Bhoopatiraju S, Wang H, Schmitz NP, Wang X, Freeman MJ, Forster CL, Verneris MR, Linden MA, Hallstrom TC

Loss of UHRF2 expression is associated with human neoplasia, promoter hypermethylation, decreased 5-hydroxymethylcytosine, and high proliferative activity

Oncotarget , 2016 Oct 12; 7(46):76047-76061. Epub 2016 Oct 12

PubMed ID: 27738314 DOI: 10.18632/oncotarget.12583

Did we miss your publication?

Have you published using HPA026633? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch