Enhanced Validation

Polyclonal Anti-UCHL1 Antibody

ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
References (24)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human UCHL1
Alternative Gene Names
PARK5, PGP9.5, Uch-L1
Open Datasheet
Price
$505.00
Product Number
HPA005993
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005993 antibody. Corresponding UCHL1 RNA-seq data are presented for the same tissues.
Show all images
[3 pictures]
Western blot analysis in human cell lines U-251MG and MCF-7 using Anti-UCHL1 antibody. Corresponding UCHL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Target Gene
UCHL1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000029223 (97%)

Rat ENSRNOG00000002343 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA005993 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA005993 on the Human Protein Atlas
Protein Name
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Gene Name
UCHL1
Alternative Gene Names
PARK5, PGP9.5, Uch-L1
UniProt ID
P09936
Gene (Ensembl)
ENSG00000154277
Entrez Gene ID
Entrez gene: 7345
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000154277 on the Human Protein Atlas

Burkart S, Weusthof C, Khorani K, Steen S, Stögbauer F, Unger K, Hess J, Zitzelsberger H, Belka C, Kurth I, Hess J

A Novel Subgroup of UCHL1-Related Cancers Is Associated with Genomic Instability and Sensitivity to DNA-Damaging Treatment

Cancers (Basel) , 2023 Mar 8; 15(6):1655. Epub 2023 Mar 8

PubMed ID: 36980544 DOI: 10.3390/cancers15061655

Lee MC, Cai H, Murray CW, Li C, Shue YT, Andrejka L, He AL, Holzem AM, Drainas AP, Ko JH, Coles GL, Kong C, Zhu S, Zhu C, Wang J, van de Rijn M, Petrov DA, Winslow MM, Sage J

A multiplexed in vivo approach to identify driver genes in small cell lung cancer

Cell Rep , 2023 Jan 13; 42(1):111990. Epub 2023 Jan 13

PubMed ID: 36640300 DOI: 10.1016/j.celrep.2023.111990

Shue YT, Drainas AP, Li NY, Pearsall SM, Morgan D, Sinnott-Armstrong N, Hipkins SQ, Coles GL, Lim JS, Oro AE, Simpson KL, Dive C, Sage J

A conserved YAP/Notch/REST network controls the neuroendocrine cell fate in the lungs

Nat Commun , 2022 May 16; 13:2690. Epub 2022 May 16

PubMed ID: 35577801 DOI: 10.1038/s41467-022-30416-2

Yousefi M, Boross G, Weiss C, Murray CW, Hebert JD, Cai H, Ashkin EL, Karmakar S, Andrejka L, Chen L, Wang M, Tsai MK, Lin WY, Li C, Yakhchalian P, Colón CI, Chew SK, Chu P, Swanton C, Kunder CA, Petrov DA, Winslow MM

Combinatorial inactivation of tumor suppressors efficiently initiates lung adenocarcinoma with therapeutic vulnerabilities

Cancer Res , 2022 Apr 15; 82(8):1589-1602

PubMed ID: 35425962 DOI: 10.1158/0008-5472.CAN-22-0059

Davies CW, Vidal SE, Phu L, Sudhamsu J, Hinkle TB, Chan Rosenberg S, Schumacher FR, Zeng YJ, Schwerdtfeger C, Peterson AS, Lill JR, Rose CM, Shaw AS, Wertz IE, Kirkpatrick DS, Koerber JT

Antibody toolkit reveals N-terminally ubiquitinated substrates of UBE2W

Nat Commun , 2021 Jul 29; 12:4608. Epub 2021 Jul 29

PubMed ID: 34326324 DOI: 10.1038/s41467-021-24669-6

Olsen RR, Ireland AS, Kastner DW, Groves SM, Spainhower KB, Pozo K, Kelenis DP, Whitney CP, Guthrie MR, Wait SJ, Soltero D, Witt BL, Quaranta V, Johnson JE, Oliver TG

ASCL1 represses a SOX9+ neural crest stem-like state in small cell lung cancer

Genes Dev , 2021 Jun; 35(11-12):847-869

PubMed ID: 34016693 DOI: 10.1101/gad.348295.121

Foggetti G, Li C, Cai H, Hellyer JA, Lin WY, Ayeni D, Hastings K, Choi J, Wurtz A, Andrejka L, Maghini DG, Rashleigh N, Levy S, Homer R, Gettinger SN, Diehn M, Wakelee HA, Petrov DA, Winslow MM, Politi K

Genetic Determinants of EGFR-Driven Lung Cancer Growth and Therapeutic Response In Vivo

Cancer Discov , 2021 Mar 11; 11(7):1736-1753. Epub 2021 Mar 11

PubMed ID: 33707235 DOI: 10.1158/2159-8290.CD-20-1385

Kooij R, Liu S, Sapmaz A, Xin BT, Janssen GM, van Veelen PA, Ovaa H, Dijke PT, Geurink PP

Small-Molecule Activity-Based Probe for Monitoring Ubiquitin C-Terminal Hydrolase L1 (UCHL1) Activity in Live Cells and Zebrafish Embryos

J Am Chem Soc , 2020 Sep 4; 142(39):16825-16841. Epub 2020 Sep 4

PubMed ID: 32886496 DOI: 10.1021/jacs.0c07726

Ireland AS, Micinski AM, Kastner DW, Guo B, Wait SJ, Spainhower KB, Conley CC, Chen OS, Guthrie MR, Soltero D, Qiao Y, Huang X, Tarapcsak S, Devarakonda S, Chalishazar MD, Gertz J, Moser JC, Marth G, Puri S, Witt BL, Spike BT, Oliver TG

MYC drives temporal evolution of small cell lung cancer subtypes by reprogramming neuroendocrine fate

Cancer Cell , 2020 May 30; 38(1):60-78.e12. Epub 2020 May 30

PubMed ID: 32473656 DOI: 10.1016/j.ccell.2020.05.001

Kwan SY, Au-Yeung CL, Yeung TL, Rynne-Vidal A, Wong KK, Risinger JI, Lin HK, Schmandt RE, Yates MS, Mok SC, Lu KH

Ubiquitin Carboxyl-Terminal Hydrolase L1 (UCHL1) Promotes Uterine Serous Cancer Cell Proliferation and Cell Cycle Progression

Cancers (Basel) , 2020 Jan 2; 12(1):118. Epub 2020 Jan 2

PubMed ID: 31906456 DOI: 10.3390/cancers12010118

Yang D, Qu F, Cai H, Chuang CH, Lim JS, Jahchan N, Grüner BM, S Kuo C, Kong C, Oudin MJ, Winslow MM, Sage J

Axon-like protrusions promote small cell lung cancer migration and metastasis

eLife , 2019 Dec 13; 8:e50616. Epub 2019 Dec 13

PubMed ID: 31833833 DOI: 10.7554/eLife.50616

Strange DP, Jiyarom B, Pourhabibi Zarandi N, Xie X, Baker C, Sadri-Ardekani H, Shi PY, Verma S

Axl Promotes Zika Virus Entry and Modulates the Antiviral State of Human Sertoli Cells

mBio , 2019 Jul 16; 10(4):e01372-19. Epub 2019 Jul 16

PubMed ID: 31311882 DOI: 10.1128/mBio.01372-19

Jia D, Augert A, Kim DW, Eastwood E, Wu N, Ibrahim AH, Kim KB, Dunn CT, Pillai SP, Gazdar AF, Bolouri H, Park KS, MacPherson D

Crebbp loss drives small cell lung cancer and increases sensitivity to HDAC inhibition

Cancer Discov , 2018 Sep 4; 8(11):1422-1437. Epub 2018 Sep 4

PubMed ID: 30181244 DOI: 10.1158/2159-8290.CD-18-0385

Yang D, Denny SK, Greenside PG, Chaikovsky AC, Brady JJ, Ouadah Y, Granja JM, Jahchan NS, Lim JS, Kwok S, Kong CS, Berghoff AS, Schmitt A, Reinhardt HC, Park KS, Preusser M, Kundaje A, Greenleaf WJ, Sage J, Winslow MM

Inter-tumoral heterogeneity in SCLC is influenced by the cell-type of origin

Cancer Discov , 2018 Sep 18; 8(10):1316-1331. Epub 2018 Sep 18

PubMed ID: 30228179 DOI: 10.1158/2159-8290.CD-17-0987

Jin Y, Zhou H, Gong L, Xia J, Yu G, Chen Y

Prognostic potential and oncogenic effects of UCH-L1 expression in hilar cholangiocarcinoma

Int J Clin Exp Pathol , 2017 Nov 1; 10(11):10802-10811. Epub 2017 Nov 1

PubMed ID: 31966423

Nakashima R, Goto Y, Koyasu S, Kobayashi M, Morinibu A, Yoshimura M, Hiraoka M, Hammond EM, Harada H

UCHL1-HIF-1 axis-mediated antioxidant property of cancer cells as a therapeutic target for radiosensitization

Sci Rep , 2017 Jul 31; 7:6879. Epub 2017 Jul 31

PubMed ID: 28761052 DOI: 10.1038/s41598-017-06605-1

Jing Shan Lim, Alvaro Ibaseta, Marcus M. Fischer, Belinda Cancilla, Gilbert O’Young, Sandra Cristea, Vincent C. Luca, Dian Yang, Nadine S. Jahchan, Cécile Hamard, Martine Antoine, Marie Wislez, Christina Kong, Jennifer Cain, Yu-Wang Liu, Ann M. Kapoun, K. Christopher Garcia, Timothy Hoey, Christopher L. Murriel, Julien Sage

Intratumoural heterogeneity generated by Notch signalling promotes small-cell lung cancer

Nature , 545, 360-364 (2017)

PubMed ID: None DOI: 10.1038/nature22323

Lim JS, Ibaseta A, Fischer MM, Cancilla B, O’Young G, Cristea S, Luca VC, Yang D, Jahchan NS, Hamard C, Antoine M, Wislez M, Kong C, Cain J, Liu YW, Kapoun AM, Garcia KC, Hoey T, Murriel CL, Sage J

Intratumoral heterogeneity generated by Notch signaling promotes small cell lung cancer

Nature , 2017 May 10; 545(7654):360-364. Epub 2017 May 10

PubMed ID: 28489825 DOI: 10.1038/nature22323

Takanori Hidaka, Eisaku Ogawa, Eri H Kobayashi, Takafumi Suzuki, Ryo Funayama, Takeshi Nagashima, Taku Fujimura, Setsuya Aiba, Keiko Nakayama, Ryuhei Okuyama, Masayuki Yamamoto

The aryl hydrocarbon receptor AhR links atopic dermatitis and air pollution via induction of the neurotrophic factor artemin

Nature Immunology , November 21, 2016

PubMed ID: None DOI: 10.1038/ni.3614

Kim DW, Wu N, Kim YC, Cheng PF, Basom R, Kim D, Dunn CT, Lee AY, Kim K, Lee CS, Singh A, Gazdar AF, Harris CR, Eisenman RN, Park KS, MacPherson D

Genetic requirement for Mycl and efficacy of RNA Pol I inhibition in mouse models of small cell lung cancer

Genes Dev , 2016 Jun 1; 30(11):1289-1299

PubMed ID: 27298335 DOI: 10.1101/gad.279307.116

Yang H, Zhang C, Fang S, Ou R, Li W, Xu Y

UCH-LI acts as a novel prognostic biomarker in gastric cardiac adenocarcinoma

Int J Clin Exp Pathol , 2015 Nov 1; 8(11):13957-13967. Epub 2015 Nov 1

PubMed ID: 26823707

Chen Y, Cha Z, Fang W, Qian B, Yu W, Li W, Yu G, Gao Y

The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma

Oncotarget , 2015 Aug 21; 6(24):20419-20433. Epub 2015 May 4

PubMed ID: 25971332 DOI: 10.18632/oncotarget.3983

Lindskog C, Asplund A, Engkvist M, Uhlen M, Korsgren O, Ponten F

Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets.

Discov Med , 2010 Jun; 9(49):565-78

PubMed ID: 20587347

Did we miss your publication?

Have you published using HPA005993? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-UCHL1 (AMAb91145)
Corresponding Antigens
PrEST Antigen UCHL1 (APrEST86224)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch