Anti-TXNRD2 Antibody

thioredoxin reductase 2
Recommended Applications
Product Description
Polyclonal Antibody against Human TXNRD2
Alternative Gene Names
TR, TR3, TRXR2
Price
$450.00
Product Number
HPA003323
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
thioredoxin reductase 2
Target Gene
TXNRD2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAIMAGRLLVQRLF
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000099282 (80%)

Rat ENSRNOG00000001890 (80%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
thioredoxin reductase 2
Gene Name
TXNRD2
Alternative Gene Names
TR, TR3, TRXR2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000184470 on the Human Protein Atlas

Sonet J, Mosca M, Bierla K, Modzelewska K, Flis-Borsuk A, Suchocki P, Ksiazek I, Anuszewska E, Bulteau AL, Szpunar J, Lobinski R, Chavatte L

Selenized Plant Oil Is an Efficient Source of Selenium for Selenoprotein Biosynthesis in Human Cell Lines

Nutrients , 2019 Jul 4; 11(7):1524. Epub 2019 Jul 4

PubMed ID: 31277500 DOI: 10.3390/nu11071524

Touat-Hamici Z, Legrain Y, Bulteau AL, Chavatte L

Selective Up-regulation of Human Selenoproteins in Response to Oxidative Stress

J Biol Chem , 2014 May 23; 289(21):14750-14761. Epub 2014 Apr 4

PubMed ID: 24706762 DOI: 10.1074/jbc.M114.551994

Wirth EK, Sheu SY, Chiu-Ugalde J, Sapin R, Klein MO, Mossbrugger I, Quintanilla-Martinez L, de Angelis MH, Krude H, Riebel T, Rothe K, Köhrle J, Schmid KW, Schweizer U, Grüters A

Monocarboxylate transporter 8 deficiency: altered thyroid morphology and persistent high triiodothyronine/thyroxine ratio after thyroidectomy.

Eur J Endocrinol , 2011 Oct; 165(4):555-61. Epub 2011 Aug 3

PubMed ID: 21813593 DOI: 10.1530/EJE-11-0369

Dammeyer P, Arnér ES

Human Protein Atlas of redox systems - what can be learnt?

Biochim Biophys Acta , 2011 Jan; 1810(1):111-38. Epub 2010 Jul 18

PubMed ID: 20647035 DOI: 10.1016/j.bbagen.2010.07.004

Wirth EK, Conrad M, Winterer J, Wozny C, Carlson BA, Roth S, Schmitz D, Bornkamm GW, Coppola V, Tessarollo L, Schomburg L, Köhrle J, Hatfield DL, Schweizer U

Neuronal selenoprotein expression is required for interneuron development and prevents seizures and neurodegeneration.

FASEB J , 2010 Mar; 24(3):844-52. Epub 2009 Nov 4

PubMed ID: 19890015 DOI: 10.1096/fj.09-143974

Did we miss your publication?

Have you published using HPA003323? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch