1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-TUFM
Enhanced Validation

Anti-TUFM Antibody

Tu translation elongation factor, mitochondrial
References (3)
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human TUFM
Alternative Gene Names
EF-TuMT, EFTu
Open Datasheet
Price
$445.00
Product Number
HPA018991
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemical staining of human duodenum, endometrium, kidney and testis using Anti-TUFM antibody HPA018991 (A) shows similar protein distribution across tissues to independent antibody HPA024087 (B).
Show all images
[1 pictures]
Western blot analysis using Anti-TUFM antibody HPA018991 (A) shows similar pattern to independent antibody HPA024087 (B).
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
Tu translation elongation factor, mitochondrial
Target Gene
TUFM
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000073838 (89%)

Rat ENSRNOG00000018604 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-TUFM HPA024087.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA018991 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA018991 on the Human Protein Atlas
Protein Name
Tu translation elongation factor, mitochondrial
Gene Name
TUFM
Alternative Gene Names
EF-TuMT, EFTu
UniProt ID
P49411
Gene (Ensembl)
ENSG00000178952
Entrez Gene ID
Entrez gene: 7284
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000178952 on the Human Protein Atlas

Christensen IB, Wu Q, Bohlbro AS, Skals MG, Damkier HH, Hübner CA, Fenton RA, Praetorius J

Genetic disruption of slc4a10 alters the capacity for cellular metabolism and vectorial ion transport in the choroid plexus epithelium

Fluids Barriers CNS , 2020 Jan 7; 17:2. Epub 2020 Jan 7

PubMed ID: 31906971 DOI: 10.1186/s12987-019-0162-5

Lei Y, Wen H, Yu Y, Taxman DJ, Zhang L, Widman DG, Swanson KV, Wen KW, Damania B, Moore CB, Giguère PM, Siderovski DP, Hiscott J, Razani B, Semenkovich CF, Chen X, Ting JP

The mitochondrial proteins NLRX1 and TUFM form a complex that regulates type I interferon and autophagy.

Immunity , 2012 Jun 29; 36(6):933-46

PubMed ID: 22749352 DOI: 10.1016/j.immuni.2012.03.025

Did we miss your publication?

Have you published using HPA018991? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-TUFM