Anti-TRPV2 Antibody

transient receptor potential cation channel, subfamily V, member 2
Recommended Applications
Product Description
Polyclonal Antibody against Human TRPV2
Alternative Gene Names
VRL, VRL-1, VRL1
Price
$450.00
Product Number
HPA044993
Unit Size
Concentration
Lot dependent
Availability
8 in Stock
Ships
Ready to Ship
Target Protein
transient receptor potential cation channel, subfamily V, member 2
Target Gene
TRPV2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000018507 (71%)

Rat ENSRNOG00000003104 (59%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
transient receptor potential cation channel, subfamily V, member 2
Gene Name
TRPV2
Alternative Gene Names
VRL, VRL-1, VRL1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000187688 on the Human Protein Atlas

Eubler K, Herrmann C, Tiefenbacher A, Köhn FM, Schwarzer JU, Kunz L, Mayerhofer A

Ca2+ Signaling and IL-8 Secretion in Human Testicular Peritubular Cells Involve the Cation Channel TRPV2

Int J Mol Sci , 2018 Sep 19; 19(9):2829. Epub 2018 Sep 19

PubMed ID: 30235802 DOI: 10.3390/ijms19092829

Elbaz M, Ahirwar D, Xiaoli Z, Zhou X, Lustberg M, Nasser MW, Shilo K, Ganju RK

TRPV2 is a novel biomarker and therapeutic target in triple negative breast cancer

Oncotarget , 2016 May 27; 9(71):33459-33470. Epub 2016 May 27

PubMed ID: 30323891 DOI: 10.18632/oncotarget.9663

Did we miss your publication?

Have you published using HPA044993? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch