Enhanced Validation

Anti-TRIM22 Antibody

tripartite motif containing 22
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human TRIM22
Alternative Gene Names
GPSTAF50, RNF94, STAF50
Price
$450.00
Product Number
HPA003575
Unit Size
Concentration
Lot dependent
Availability
1 in Stock
Ships
Ready to Ship
Target Protein
tripartite motif containing 22
Target Gene
TRIM22
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000042686 (54%)

Mouse ENSMUSG00000056144 (54%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
tripartite motif containing 22
Gene Name
TRIM22
Alternative Gene Names
GPSTAF50, RNF94, STAF50
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000132274 on the Human Protein Atlas

Tian H, He Z

miR-215 Enhances HCV Replication by Targeting TRIM22 and Inactivating NF-κB Signaling

Yonsei Med J , 2018 May 3; 59(4):511-518. Epub 2018 May 3

PubMed ID: 29749134 DOI: 10.3349/ymj.2018.59.4.511

Singh R, Patel V, Mureithi MW, Naranbhai V, Ramsuran D, Tulsi S, Hiramen K, Werner L, Mlisana K, Altfeld M, Luban J, Kasprowicz V, Dheda K, Abdool Karim SS, Ndung'u T

TRIM5α and TRIM22 Are Differentially Regulated According to HIV-1 Infection Phase and Compartment

J Virol , 2014 Apr; 88(8):4291-4303

PubMed ID: 24478420 DOI: 10.1128/JVI.03603-13

Carotenuto M, Pedone E, Diana D, de Antonellis P, Džeroski S, Marino N, Navas L, Di Dato V, Scoppettuolo MN, Cimmino F, Correale S, Pirone L, Monti SM, Bruder E, Ženko B, Slavkov I, Pastorino F, Ponzoni M, Schulte JH, Schramm A, Eggert A, Westermann F, Arrigoni G, Accordi B, Basso G, Saviano M, Fattorusso R, Zollo M

Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction

Sci Rep , 2013; 3:1351. Epub 2013 Mar 1

PubMed ID: 23448979 DOI: 10.1038/srep01351

Singh R, Gaiha G, Werner L, McKim K, Mlisana K, Luban J, Walker BD, Karim SS, Brass AL, Ndung'u T, and the CAPRISA Acute Infection Study Team

Association of TRIM22 with the Type 1 Interferon Response and Viral Control during Primary HIV-1 Infection

J Virol , 2011 Jan; 85(1):208-216. Epub 2010 Oct 27

PubMed ID: 20980524 DOI: 10.1128/JVI.01810-10

Petersson J, Lönnbro P, Herr AM, Mörgelin M, Gullberg U, Drott K

The human IFN-inducible p53 target gene TRIM22 colocalizes with the centrosome independently of cell cycle phase.

Exp Cell Res , 2010 Feb 15; 316(4):568-79. Epub 2009 Dec 16

PubMed ID: 20006605 DOI: 10.1016/j.yexcr.2009.12.007

Did we miss your publication?

Have you published using HPA003575? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch