1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-TRAF3

Anti-TRAF3 Antibody

TNF receptor-associated factor 3
References (2)
Recommended Applications
Product Description
Polyclonal Antibody against Human TRAF3
Alternative Gene Names
CAP-1, CD40bp, CRAF1, LAP1
Open Datasheet
Price
$450.00
Product Number
HPA002933
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
TNF receptor-associated factor 3
Target Gene
TRAF3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000021277 (93%)

Rat ENSRNOG00000008145 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
TNF receptor-associated factor 3
Gene Name
TRAF3
Alternative Gene Names
CAP-1, CD40bp, CRAF1, LAP1
UniProt ID
Q13114
Gene (Ensembl)
ENSG00000131323
Entrez Gene ID
Entrez gene: 7187
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000131323 on the Human Protein Atlas

Into T, Niida S, Shibata KI

MyD88 signaling causes autoimmune sialadenitis through formation of high endothelial venules and upregulation of LTβ receptor-mediated signaling

Sci Rep , 2018 Sep 24; 8:14272. Epub 2018 Sep 24

PubMed ID: 30250175 DOI: 10.1038/s41598-018-32690-x

Did we miss your publication?

Have you published using HPA002933? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen TRAF3 (APrEST70567)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-TRAF3