Polyclonal Anti-TOR1AIP1 Antibody

torsin 1A interacting protein 1
References (1)
Recommended Applications
Product Description
Polyclonal Antibody against Human TOR1AIP1
Alternative Gene Names
FLJ13142, LAP1B
Open Datasheet
Price
$379.00
Product Number
HPA070991
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human stomach shows strong nuclear membranous positivity in glandular cells.
Show all images
[1 pictures]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
torsin 1A interacting protein 1
Target Gene
TOR1AIP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000003946 (85%)

Mouse ENSMUSG00000026466 (84%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
25 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA070991 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
torsin 1A interacting protein 1
Gene Name
TOR1AIP1
Alternative Gene Names
FLJ13142, LAP1B
UniProt ID
Q5JTV8
Gene (Ensembl)
ENSG00000143337
Entrez Gene ID
Entrez gene: 26092
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000143337 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA070991? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-TOR1AIP1 (HPA047151)
Anti-TOR1AIP1 (HPA050546)
Corresponding Antigens
PrEST Antigen TOR1AIP1 (APrEST95060)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch