Enhanced Validation

Anti-TOP2A Antibody

topoisomerase (DNA) II alpha 170kDa
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TOP2A
Alternative Gene Names
TOP2
Price
$445.00
Product Number
HPA006458
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
topoisomerase (DNA) II alpha 170kDa
Target Gene
TOP2A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000020914 (63%)

Rat ENSRNOG00000053047 (60%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
topoisomerase (DNA) II alpha 170kDa
Gene Name
TOP2A
Alternative Gene Names
TOP2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000131747 on the Human Protein Atlas

Ma X, Zhou L, Zheng S

Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma

PeerJ , 2020 Apr 8; 8:e8930. Epub 2020 Apr 8

PubMed ID: 32296612 DOI: 10.7717/peerj.8930

Shan S, Chen W, Jia JD

Transcriptome Analysis Revealed a Highly Connected Gene Module Associated With Cirrhosis to Hepatocellular Carcinoma Development

Front Genet , 2019 Apr 2; 10:305. Epub 2019 Apr 2

PubMed ID: 31001331 DOI: 10.3389/fgene.2019.00305

Keiko Mizuno, Hiroko Mataki, Takayuki Arai, Atsushi Okato, Kazuto Kamikawaji, Tomohiro Kumamoto, Tsubasa Hiraki, Kazuhito Hatanaka, Hiromasa Inoue, Naohiko Seki

The microRNA expression signature of small cell lung cancer: tumor suppressors of miR-27a-5p and miR-34b-3p and their targeted oncogenes

Journal of Human Genetics , March 09, 2017

PubMed ID: None DOI: 10.1038/jhg.2017.27

Andersson S, Konrad A, Ashok N, Pontén F, Hober S, Asplund A

Antibodies Biotinylated Using a Synthetic Z-domain from Protein A Provide Stringent In Situ Protein Detection

J Histochem Cytochem , 2013 Nov; 61(11):773-784

PubMed ID: 23920108 DOI: 10.1369/0022155413502360

Lindén M, Segersten U, Runeson M, Wester K, Busch C, Pettersson U, Lind SB, Malmström PU

Tumour expression of bladder cancer-associated urinary proteins.

BJU Int , 2013 Aug; 112(3):407-15. Epub 2013 Mar 7

PubMed ID: 23470167 DOI: 10.1111/j.1464-410X.2012.11653.x

Did we miss your publication?

Have you published using HPA006458? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch