Enhanced Validation

Anti-TOMM22 Antibody

translocase of outer mitochondrial membrane 22 homolog (yeast)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human TOMM22
Alternative Gene Names
TOM22
Price
$437.00
Product Number
HPA003037
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
translocase of outer mitochondrial membrane 22 homolog (yeast)
Target gene
TOMM22
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022427 (92%)

Rat ENSRNOG00000014058 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
translocase of outer mitochondrial membrane 22 homolog (yeast)
Gene Name
TOMM22
Alternative Gene Names
TOM22
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100216 on the Human Protein Atlas

Mollá B, Riveiro F, Bolinches-Amorós A, Muñoz-Lasso DC, Palau F, González-Cabo P

Two different pathogenic mechanisms, dying-back axonal neuropathy and pancreatic senescence, are present in the YG8R mouse model of Friedreich’s ataxia

Dis Model Mech , 2016 Jun 1; 9(6):647-657

PubMed ID: 27079523 DOI: 10.1242/dmm.024273

Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra FJ

Global variability in gene expression and alternative splicing is modulated by mitochondrial content

Genome Res , 2015 May; 25(5):633-644

PubMed ID: 25800673 DOI: 10.1101/gr.178426.114

Latil M, Rocheteau P, Châtre L, Sanulli S, Mémet S, Ricchetti M, Tajbakhsh S, Chrétien F

Skeletal muscle stem cells adopt a dormant cell state post mortem and retain regenerative capacity.

Nat Commun , 2012 Jun 12; 3:903. Epub 2012 Jun 12

PubMed ID: 22692546 DOI: 10.1038/ncomms1890

Did we miss your publication?

Have you published using HPA003037? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens