Anti-TNFRSF1A Antibody

tumor necrosis factor receptor superfamily, member 1A
Recommended Applications
Product Description
Polyclonal Antibody against Human TNFRSF1A
Alternative Gene Names
CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
Price
$445.00
Product Number
HPA004102
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
tumor necrosis factor receptor superfamily, member 1A
Target Gene
TNFRSF1A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000030341 (72%)

Rat ENSRNOG00000031312 (70%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
tumor necrosis factor receptor superfamily, member 1A
Gene Name
TNFRSF1A
Alternative Gene Names
CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000067182 on the Human Protein Atlas

Yang B, Pan YB, Ma YB, Chu SH

Integrated Transcriptome Analyses and Experimental Verifications of Mesenchymal-Associated TNFRSF1A as a Diagnostic and Prognostic Biomarker in Gliomas

Front Oncol , 2020 Mar 17; 10:250. Epub 2020 Mar 17

PubMed ID: 32257943 DOI: 10.3389/fonc.2020.00250

Did we miss your publication?

Have you published using HPA004102? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch