Anti-TMX2 Antibody

thioredoxin-related transmembrane protein 2
References (3)
Recommended Applications
Product Description
Polyclonal Antibody against Human TMX2
Alternative Gene Names
PDIA12, TXNDC14
Open Datasheet
Price
$459.00
Product Number
HPA040282
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
thioredoxin-related transmembrane protein 2
Target Gene
TMX2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000050043 (99%)

Rat ENSRNOG00000005308 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
thioredoxin-related transmembrane protein 2
Gene Name
TMX2
Alternative Gene Names
PDIA12, TXNDC14
UniProt ID
Q9Y320
Gene (Ensembl)
ENSG00000213593
Entrez Gene ID
Entrez gene: 51075
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000213593 on the Human Protein Atlas

Vandervore LV, Schot R, Milanese C, Smits DJ, Kasteleijn E, Fry AE, Pilz DT, Brock S, Börklü-Yücel E, Post M, Bahi-Buisson N, Sánchez-Soler MJ, van Slegtenhorst M, Keren B, Afenjar A, Coury SA, Tan WH, Oegema R, de Vries LS, Fawcett KA, Nikkels PG, Bertoli-Avella A, Al Hashem A, Alwabel AA, Tlili-Graiess K, Efthymiou S, Zafar F, Rana N, Bibi F, Houlden H, Maroofian R, Person RE, Crunk A, Savatt JM, Turner L, Doosti M, Karimiani EG, Saadi NW, Akhondian J, Lequin MH, Kayserili H, van der Spek PJ, Jansen AC, Kros JM, Verdijk RM, Milošević NJ, Fornerod M, Mastroberardino PG, Mancini GM

TMX2 Is a Crucial Regulator of Cellular Redox State, and Its Dysfunction Causes Severe Brain Developmental Abnormalities

Am J Hum Genet , 2019 Nov 14; 105(6):1126-1147. Epub 2019 Nov 14

PubMed ID: 31735293 DOI: 10.1016/j.ajhg.2019.10.009

Soni S, Raaijmakers AJ, Raaijmakers LM, Damen JM, van Stuijvenberg L, Vos MA, Heck AJ, van Veen TA, Scholten A

A Proteomics Approach to Identify New Putative Cardiac Intercalated Disk Proteins

PLoS One , 2016 May 5; 11(5):e0152231. Epub 2016 May 5

PubMed ID: 27148881 DOI: 10.1371/journal.pone.0152231

Did we miss your publication?

Have you published using HPA040282? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-TMX2 (HPA063763)
Corresponding Antigens
PrEST Antigen TMX2 (APrEST80849)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch