Enhanced Validation

Polyclonal Anti-TMPRSS2 Antibody

transmembrane protease, serine 2
References (15)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TMPRSS2
Alternative Gene Names
PRSS10
Open Datasheet
Price
$505.00
Product Number
HPA035787
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human prostate and cerebral cortex tissues using HPA035787 antibody. Corresponding TMPRSS2 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in control (vector only transfected HEK293T lysate) and TMPRSS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401727).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
transmembrane protease, serine 2
Target Gene
TMPRSS2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000000385 (66%)

Rat ENSRNOG00000001976 (66%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA035787 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
transmembrane protease, serine 2
Gene Name
TMPRSS2
Alternative Gene Names
PRSS10
UniProt ID
O15393
Gene (Ensembl)
ENSG00000184012
Entrez Gene ID
Entrez gene: 7113
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000184012 on the Human Protein Atlas

Fu J, Liu S, Tan Q, Liu Z, Qian J, Li T, Du J, Song B, Li D, Zhang L, He J, Guo K, Zhou B, Chen H, Fu S, Liu X, Cheng J, He T, Fu J

Impact of TMPRSS2 Expression, Mutation Prognostics, and Small Molecule (CD, AD, TQ, and TQFL12) Inhibition on Pan-Cancer Tumors and Susceptibility to SARS-CoV-2

Molecules , 2022 Nov 1; 27(21):7413. Epub 2022 Nov 1

PubMed ID: 36364238 DOI: 10.3390/molecules27217413

Roelle SM, Shukla N, Pham AT, Bruchez AM, Matreyek KA

Expanded ACE2 dependencies of diverse SARS-like coronavirus receptor binding domains

PLoS Biol , 2022 Jul 27; 20(7):e3001738. Epub 2022 Jul 27

PubMed ID: 35895696 DOI: 10.1371/journal.pbio.3001738

Arefin S, Hernandez L, Ward LJ, Schwarz A, GOING‐FWD CollaboratorsPiloteLouiseLNorrisColleen M.CMRaparelliValeriaVKautzky‐WillerAlexandraAKublickieneKarolinaKTrinidad HerreroMariaM , Barany P, Stenvinkel P, Kublickiene K

Angiotensin‐converting enzyme 2 and transmembrane protease serine 2 in female and male patients with end‐stage kidney disease

Eur J Clin Invest , 2022 Apr 9; 52(8):e13786. Epub 2022 Apr 9

PubMed ID: 35366343 DOI: 10.1111/eci.13786

Bräutigam K, Reinhard S, Galván JA, Wartenberg M, Hewer E, Schürch CM

Systematic Investigation of SARS-CoV-2 Receptor Protein Distribution along Viral Entry Routes in Humans

Respiration , . Epub 2022 Jan 17

PubMed ID: 35038715 DOI: 10.1159/000521317

Rajah MM, Hubert M, Bishop E, Saunders N, Robinot R, Grzelak L, Planas D, Dufloo J, Gellenoncourt S, Bongers A, Zivaljic M, Planchais C, Guivel‐Benhassine F, Porrot F, Mouquet H, Chakrabarti LA, Buchrieser J, Schwartz O

SARS‐CoV‐2 Alpha, Beta, and Delta variants display enhanced Spike‐mediated syncytia formation

EMBO J , . Epub 2021 Oct 25

PubMed ID: 34601723 DOI: 10.15252/embj.2021108944

Martin G, Wolf J, Lapp T, Agostini HT, Schlunck G, Auw-Hädrich C, Lange CA

Viral S protein histochemistry reveals few potential SARS-CoV-2 entry sites in human ocular tissues

Sci Rep , 2021 Sep 27; 11:19140. Epub 2021 Sep 27

PubMed ID: 34580409 DOI: 10.1038/s41598-021-98709-y

Cecon E, Burridge M, Cao L, Carter L, Ravichandran R, Dam J, Jockers R

SARS-COV-2 spike binding to ACE2 in living cells monitored by TR-FRET

Cell Chem Biol , . Epub 2021 Jul 2

PubMed ID: 34246414 DOI: 10.1016/j.chembiol.2021.06.008

Colson A, Depoix CL, Dessilly G, Baldin P, Danhaive O, Hubinont C, Sonveaux P, Debiève F

Clinical and in Vitro Evidence against Placenta Infection at Term by Severe Acute Respiratory Syndrome Coronavirus 2

Am J Pathol , 2021 Jun 8; 191(9):1610-1623. Epub 2021 Jun 8

PubMed ID: 34111431 DOI: 10.1016/j.ajpath.2021.05.009

Colson A, Depoix CL, Dessilly G, Baldin P, Danhaive O, Hubinont C, Sonveaux P, Debiève F

COVID-19 during Pregnancy: Clinical and In Vitro Evidence against Placenta Infection at Term by SARS-CoV-2

Am J Pathol , . Epub 2021 Jun 8

PubMed ID: 34111431 DOI: 10.1016/j.ajpath.2021.05.009

Kwan JY, Lin LT, Bell R, Bruce JP, Richardson C, Pugh TJ, Liu FF

Elevation in viral entry genes and innate immunity compromise underlying increased infectivity and severity of COVID-19 in cancer patients

Sci Rep , 2021 Feb 25; 11:4533. Epub 2021 Feb 25

PubMed ID: 33633121 DOI: 10.1038/s41598-021-83366-y

Jin RU, Brown JW, Li QK, Bayguinov PO, Wang JS, Mills JC

Tropism of Severe Acute Respiratory Syndrome Coronavirus 2 for Barrett’s Esophagus May Increase Susceptibility to Developing Coronavirus Disease 2019

Gastroenterology , . Epub 2021 Jan 20

PubMed ID: 33484686 DOI: 10.1053/j.gastro.2021.01.024

Buchrieser J, Dufloo J, Hubert M, Monel B, Planas D, Rajah MM, Planchais C, Porrot F, Guivel‐Benhassine F, Van der Werf S, Casartelli N, Mouquet H, Bruel T, Schwartz O

Syncytia formation by SARS‐CoV‐2‐infected cells

EMBO J , . Epub 2020 Nov 4

PubMed ID: 33051876 DOI: 10.15252/embj.2020106267

Coate KC, Cha J, Shrestha S, Wang W, Gonçalves LM, Almaça J, Kapp ME, Fasolino M, Morgan A, Dai C, Saunders DC, Bottino R, Aramandla R, Jenkins R, Stein R, Kaestner KH, Vahedi G, HPAP Consortium, Brissova M, Powers AC

SARS-CoV-2 Cell Entry Factors ACE2 and TMPRSS2 Are Expressed in the Microvasculature and Ducts of Human Pancreas but Are Not Enriched in β Cells

Cell Metab , 2020 Nov 13; 32(6):1028-1040.e4. Epub 2020 Nov 13

PubMed ID: 33207245 DOI: 10.1016/j.cmet.2020.11.006

Aguiar JA, Tremblay BJ, Mansfield MJ, Woody O, Lobb B, Banerjee A, Chandiramohan A, Tiessen N, Cao Q, Dvorkin-Gheva A, Revill S, Miller MS, Carlsten C, Organ L, Joseph C, John A, Hanson P, Austin RC, McManus BM, Jenkins G, Mossman K, Ask K, Doxey AC, Hirota JA

Gene expression and in situ protein profiling of candidate SARS-CoV-2 receptors in human airway epithelial cells and lung tissue

Eur Respir J , 2020 Sep 3; 56(3):2001123. Epub 2020 Sep 3

PubMed ID: 32675206 DOI: 10.1183/13993003.01123-2020

Did we miss your publication?

Have you published using HPA035787? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch