Enhanced Validation

Anti-TMF1 Antibody

TATA element modulatory factor 1
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human TMF1
Alternative Gene Names
ARA160, TMF
Price
$450.00
Product Number
HPA008729
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
TATA element modulatory factor 1
Target Gene
TMF1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TSTTSDIEVLDHESVISESSASSRQETTDSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESG
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000030059 (87%)

Rat ENSRNOG00000056462 (84%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
TATA element modulatory factor 1
Gene Name
TMF1
Alternative Gene Names
ARA160, TMF
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000144747 on the Human Protein Atlas

Wong M, Gillingham AK, Munro S

The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs

BMC Biol , 2017 Jan 26; 15:3. Epub 2017 Jan 26

PubMed ID: 28122620 DOI: 10.1186/s12915-016-0345-3

Wong M, Munro S

The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins

Science , 2014 Oct 31; 346(6209):1256898

PubMed ID: 25359980 DOI: 10.1126/science.1256898

Bel S, Elkis Y, Lerer-Goldstein T, Nyska A, Shpungin S, Nir U

Loss of TMF/ARA160 Protein Renders Colonic Mucus Refractory to Bacterial Colonization and Diminishes Intestinal Susceptibility to Acute Colitis

J Biol Chem , 2012 Jul 20; 287(30):25631-25639. Epub 2012 May 2

PubMed ID: 22553199 DOI: 10.1074/jbc.M112.364786

Arabi A, Ullah K, Branca RM, Johansson J, Bandarra D, Haneklaus M, Fu J, Ariës I, Nilsson P, Den Boer ML, Pokrovskaja K, Grandér D, Xiao G, Rocha S, Lehtiö J, Sangfelt O

Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway.

Nat Commun , 2012; 3:976

PubMed ID: 22864569 DOI: 10.1038/ncomms1975

Did we miss your publication?

Have you published using HPA008729? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch