Enhanced Validation

Anti-TFRC Antibody

transferrin receptor
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TFRC
Alternative Gene Names
CD71, p90, TFR1
Price
$445.00
Product Number
HPA028598
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
transferrin receptor
Target Gene
TFRC
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000022797 (61%)

Rat ENSRNOG00000001766 (57%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
transferrin receptor
Gene Name
TFRC
Alternative Gene Names
CD71, p90, TFR1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000072274 on the Human Protein Atlas

Fan K, Xi J, Fan L, Wang P, Zhu C, Tang Y, Xu X, Liang M, Jiang B, Yan X, Gao L

In vivo guiding nitrogen-doped carbon nanozyme for tumor catalytic therapy

Nat Commun , 2018 Apr 12; 9:1440. Epub 2018 Apr 12

PubMed ID: 29650959 DOI: 10.1038/s41467-018-03903-8

Ta H, Keller J, Haltmeier M, Saka SK, Schmied J, Opazo F, Tinnefeld P, Munk A, Hell SW

Mapping molecules in scanning far-field fluorescence nanoscopy

Nat Commun , 2015 Aug 13; 6:7977. Epub 2015 Aug 13

PubMed ID: 26269133 DOI: 10.1038/ncomms8977

Lenarduzzi M, Hui AB, Yue S, Ito E, Shi W, Williams J, Bruce J, Sakemura-Nakatsugawa N, Xu W, Schimmer A, Liu FF

Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer

PLoS One , 2013; 8(8):e74075. Epub 2013 Aug 26

PubMed ID: 23991213 DOI: 10.1371/journal.pone.0074075

Did we miss your publication?

Have you published using HPA028598? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch