Enhanced Validation

Anti-TFF1 Antibody

trefoil factor 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human TFF1
Alternative Gene Names
BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Price
$437.00
Product Number
HPA003425
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
trefoil factor 1
Target gene
TFF1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000001164 (66%)

Mouse ENSMUSG00000024032 (64%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
trefoil factor 1
Gene Name
TFF1
Alternative Gene Names
BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000160182 on the Human Protein Atlas

Agata Zieba, Fredrik Ponten, Mathias Uhlén, Ulf Landegren

In situ protein detection with enhanced specificity using DNA-conjugated antibodies and proximity ligation

Modern Pathology , September 22, 2017

DOI: 10.1038/modpathol.2017.102

Drabovich AP, Pavlou MP, Schiza C, Diamandis EP

Dynamics of Protein Expression Reveals Primary Targets and Secondary Messengers of Estrogen Receptor Alpha Signaling in MCF-7 Breast Cancer Cells

Mol Cell Proteomics , 2016 Apr 11; 15(6):2093-2107. Epub 2016 Apr 11

PubMed ID: 27067054 DOI: 10.1074/mcp.M115.057257

Uhlén M, Oksvold P, Älgenäs C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Pontén F, Kondo T, Sivertsson Å

Antibody-based Protein Profiling of the Human Chromosome 21

Mol Cell Proteomics , 2012 Mar; 11(3):M111.013458. Epub 2011 Oct 31

PubMed ID: 22042635 DOI: 10.1074/mcp.M111.013458

Davidson B, Stavnes HT, Holth A, Chen X, Yang Y, Shih IeM, Wang TL

Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions.

J Cell Mol Med , 2011 Mar; 15(3):535-44. Epub 2010 Jan 28

PubMed ID: 20132413 DOI: 10.1111/j.1582-4934.2010.01019.x

Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS

Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas

Mol Cell Proteomics , 2010 Jun; 9(6):1100-1117. Epub 2010 Feb 1

PubMed ID: 20124221 DOI: 10.1074/mcp.M900398-MCP200

Pontén F, Jirström K, Uhlen M

The Human Protein Atlas--a tool for pathology.

J Pathol , 2008 Dec; 216(4):387-93

PubMed ID: 18853439 DOI: 10.1002/path.2440

Did we miss your publication?

Have you published using HPA003425? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch