1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-TFAP4
Enhanced Validation

Anti-TFAP4 Antibody

transcription factor AP-4 (activating enhancer binding protein 4)
References (5)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human TFAP4
Alternative Gene Names
AP-4, bHLHc41
Open Datasheet
Price
$450.00
Product Number
HPA001912
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Show all images
[3 pictures]
Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TFAP4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
transcription factor AP-4 (activating enhancer binding protein 4)
Target Gene
TFAP4
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000005227 (100%)

Mouse ENSMUSG00000005718 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA001912 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001912 on the Human Protein Atlas
Protein Name
transcription factor AP-4 (activating enhancer binding protein 4)
Gene Name
TFAP4
Alternative Gene Names
AP-4, bHLHc41
UniProt ID
Q01664
Gene (Ensembl)
ENSG00000090447
Entrez Gene ID
Entrez gene: 7023
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000090447 on the Human Protein Atlas

Cramer ML, Xu R, Martin PT

Soluble Heparin Binding Epidermal Growth Factor-Like Growth Factor Is a Regulator of GALGT2 Expression and GALGT2-Dependent Muscle and Neuromuscular Phenotypes

Mol Cell Biol , 2019 Jun 27; 39(14):e00140-19. Epub 2019 Jun 27

PubMed ID: 31036568 DOI: 10.1128/MCB.00140-19

Savio AJ, Bapat B

Modulation of transcription factor binding and epigenetic regulation of the MLH1 CpG island and shore by polymorphism rs1800734 in colorectal cancer

Epigenetics , 2017 Mar 17; 12(6):441-448. Epub 2017 Mar 17

PubMed ID: 28304185 DOI: 10.1080/15592294.2017.1305527

Xue C, Yu DM, Gherardi S, Koach J, Milazzo G, Gamble L, Liu B, Valli E, Russell AJ, London WB, Liu T, Cheung BB, Marshall GM, Perini G, Haber M, Norris MD

MYCN promotes neuroblastoma malignancy by establishing a regulatory circuit with transcription factor AP4

Oncotarget , 2016 Jul 19; 7(34):54937-54951. Epub 2016 Jul 19

PubMed ID: 27448979 DOI: 10.18632/oncotarget.10709

Jackstadt R, Röh S, Neumann J, Jung P, Hoffmann R, Horst D, Berens C, Bornkamm GW, Kirchner T, Menssen A, Hermeking H

AP4 is a mediator of epithelial–mesenchymal transition and metastasis in colorectal cancer

J Exp Med , 2013 Jul 1; 210(7):1331-1350

PubMed ID: 23752226 DOI: 10.1084/jem.20120812

Did we miss your publication?

Have you published using HPA001912? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen TFAP4 (APrEST84739)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-TFAP4