Anti-TBX19 Antibody

T-box 19
Recommended Applications
Product Description
Polyclonal Antibody against Human TBX19
Alternative Gene Names
dj747L4.1, TPIT
Price
$450.00
Product Number
HPA072686
Unit Size
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
T-box 19
Target Gene
TBX19
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026572 (82%)

Rat ENSRNOG00000025634 (32%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Protein Name
T-box 19
Gene Name
TBX19
Alternative Gene Names
dj747L4.1, TPIT
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000143178 on the Human Protein Atlas

Sjöstedt E, Kolnes AJ, Olarescu NC, Mitsios N, Hikmet F, Sivertsson Å, Lindskog C, Øystese KA, Jørgensen AP, Bollerslev J, Casar-Borota O

TGFBR3L—An Uncharacterised Pituitary Specific Membrane Protein Detected in the Gonadotroph Cells in Non-Neoplastic and Tumour Tissue

Cancers (Basel) , 2020 Dec 31; 13(1):114. Epub 2020 Dec 31

PubMed ID: 33396509 DOI: 10.3390/cancers13010114

Peculis R, Mandrika I, Petrovska R, Dortane R, Megnis K, Nazarovs J, Balcere I, Stukens J, Konrade I, Pirags V, Klovins J, Rovite V

Pituispheres Contain Genetic Variants Characteristic to Pituitary Adenoma Tumor Tissue

Front Endocrinol (Lausanne) , 2020 May 22; 11:313. Epub 2020 May 22

PubMed ID: 32528411 DOI: 10.3389/fendo.2020.00313

Uraki S, Ariyasu H, Doi A, Takeshima K, Morita S, Inaba H, Furuta H, Fukuhara N, Inoshita N, Nishioka H, Nakao N, Yamada S, Akamizu T

MSH6/2 and PD-L1 Expressions Are Associated with Tumor Growth and Invasiveness in Silent Pituitary Adenoma Subtypes

Int J Mol Sci , 2020 Apr 18; 21(8):2831. Epub 2020 Apr 18

PubMed ID: 32325698 DOI: 10.3390/ijms21082831

Sjöstedt E, Bollerslev J, Mulder J, Lindskog C, Pontén F, Casar-Borota O

A specific antibody to detect transcription factor T-Pit: a reliable marker of corticotroph cell differentiation and a tool to improve the classification of pituitary neuroendocrine tumours.

Acta Neuropathol , 2017 Oct; 134(4):675-677

PubMed ID: 28823042 DOI: 10.1007/s00401-017-1768-9

Did we miss your publication?

Have you published using HPA072686? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch